IL-11 Protein, Human (CHO)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IL-11 Protein, Human (CHO) is a CHO cell derived protective factor, which has a protective role and can accelerate recovery of platelets, and remarkably lessen the extent of inflammatory responses.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-11 Protein, Human (CHO) is a CHO cell derived protective factor, which has a protective role and can accelerate recovery of platelets, and remarkably lessen the extent of inflammatory responses.

Background

Recombinant Human Interleukin-11 (IL-11) plays a very crucial role in inflammation. Being an essential cytokine, IL-11 promotes chronic gastric inflammation and also associated with STAT3 and STAT1 mediated tumorigenesis. In addition, IL-11 is also an indispensable factor in IL-13- induced Th2-mediated inflammatory disorders and tissue remodeling. IL-11 has diverse biological functions. It has a protective role against neutron radiation injury, capable of promoting a faster recovery of small intestine injuries and also functions in response to inflammation in animal models of infection. Studies have revealed that IL-11 protects animal models of sepsis from liver injuries. Although its role in platelet production in neonates remains unclear, IL-11 is reported to be involved in the endogenous cytokine response to sepsis or Necrotizing Enterocolitis (NEC) in premmies. IL-11 is also involved in NF-κB signaling pathway and inhibition of IL-6 can reduce colitis associated tumorigenesis [1]. Recombinant human interleukin-11 directly promotes megakaryocytopoiesis in vitro[2].

Verified Bioactivity

The ED50 is <5 ng/mL as measured in a proliferation assay by TF-1 cells.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-11 (P22-L199)
      Accession # P289-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    IL11; Adipogenesis Inhibitory Factor; Interleukin 11; Interleukin-11; IL-11; Oprelvekin; AGIF

  • AA Sequence

    PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00