BD-2 Protein, Mouse
Based on 1 Customer Validation
BD-2 Protein, Mouse is an anti-microbial peptide that participates in the response to microbial invasion.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
BD-2 Protein, Mouse is an anti-microbial peptide that participates in the response to microbial invasion.
Mouse Beta Defensin-2 (mBD2) is produced by mouse urothelium in response to intravesicular BCG as a defense mechanism against BCG, and blocking mBD2 by an anti-mBD2 antibody increased the effectiveness of BCG[1].
Full biological activity determined by a chemotaxis bioassay using immature human dendritic cells is in a concentration of 10-100 ng/ml.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P82020 (A21-K71)
-
Gene ID13215 [NCBI]
-
Molecular Construction
-
N-term
-
BD-2 (A21-K71)
Accession # P82020 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Defensin beta 4A; Beta-defensin 2; BD-2; hBD-2; Defensin; beta 2; Skin-antimicrobial peptide 1; SAP1; DEFB4A; DEFB102; DEFB2; DEFB4; DEFB4B
-
AA Sequence
AVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYMK
-
Predicted Molecular Mass
5.5 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (259 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)