IL-5 Protein, Mouse

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IL-5 Protein, Mouse is a hematopoietic growth factor expressed in Th2, mast cells and eosinophils.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-5 Protein, Mouse is a hematopoietic growth factor expressed in Th2, mast cells and eosinophils.

Background

Interleukin-5 (IL-5), which is produced primarily by type 2 T helper lymphocytes (Th2), is an eosinophil differentiation and activation factor. Antagonism of IL-5 activity is being explored as a potential treatment of a number of disease conditions associated with eosinophils in animal models[1]. Interleukin-5 (IL-5) which was previously named T cell replacing factor, B cell growth and differentiation factor, colony forming unit growth stimulating factor and eosinophil differentiation factor is produced predominantly by T cells. Mouse IL-5 is active as a growth factor on mouse but not human B cells. Mouse IL-5 stimulates the production and secretion of IgM and IgA by B cells in synergism with bacterial endotoxins. IL-5 has also been found to promote the generation of cytotoxic cells from human and mouse thymocytes. IL-5 is a potent growth promoter of early haemopoeitic progenitor cells. It stimulates the production of eosinophits from mouse, human and sheep in vitro and controls the production of eosinophils in vivo. Mouse IL-5 possesses eosinophil potentiating activity[2].

Verified Bioactivity

The ED50 is <2.0 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >5.0 × 105 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-5 (M21-G133)
      Accession # P04401
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL5; T-Cell Replacing Factor; Interleukin 5; EDF; Eosinophil Differentiation Factor; Colony-Stimulating Factor, Eosinophil; Interleukin-5; B-Cell Differentiation Factor I; IL-5; Interleukin 5 (Colony-Stimulating Factor, Eosinophil); TRF; B Cell Differenti

  • AA Sequence

    MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

  • Molecular Weight

    Approximately 26 kDa, based on SDS-PAGE under non reducing (N) conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00