FGF-9 Protein, Rat
Based on 1 Customer Validation
FGF-9 Protein, Rat is a steroid-regulated mitogen and survival factor for nerve and mesenchymal cells.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
FGF-9 Protein, Rat is a steroid-regulated mitogen and survival factor for nerve and mesenchymal cells.
Background
Fibroblast growth factor-9 (FGF-9) is a steroid-regulated mitogen and survival factor for nerve and mesenchymal cells. FGF-9 is an autocrine/paracrine growth factor considered to be important for the growth and survival of motorneurons and prostate tissue[1].
Verified Bioactivity
The ED50 is <0.5 ng/mL as measured by FGF-receptors transfected BaF3 cells, corresponding to a specific activity of >2.0 × 106 units/mg.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
P36364 (L4-S208)
-
Molecular Construction
-
N-term
-
FGF-9 (L4-S208)
Accession # P36364 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGF9; FGF-9; Fibroblast Growth Factor 9; GAF; Fibroblast Growth Factor 9 (Glia-Activating Factor); Fibroblast Growth Factor; Heparin-Binding Growth Factor 9; HBFG-9; Glia-Activating Factor; SYNS3; HBGF-9; FGF
-
AA Sequence
LGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
-
Predicted Molecular Mass
23.1 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 400 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)