Copy Link Print Information

FGF-9 Protein, Human (HEK293, Fc, solution)

Customer Review

Based on 1 Customer Validation

Activin AB protein is a member of the transforming growth factor-β (TGF-β) superfamily and plays a key role in various biological processes such as cell differentiation, proliferation, and apoptosis. It is involved in embryonic development, tissue repair and immune regulation. FGF-9 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived FGF-9 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for FGF-9 Protein, Human (HEK293, Fc, solution)
  • FGF-9 Protein, Human (HEK293, Fc, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Activin AB protein is a member of the transforming growth factor-β (TGF-β) superfamily and plays a key role in various biological processes such as cell differentiation, proliferation, and apoptosis. It is involved in embryonic development, tissue repair and immune regulation. FGF-9 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived FGF-9 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

The FGF-9 Protein, belonging to the fibroblast growth factor (FGF) family, exhibits broad mitogenic and cell survival activities, participating in various biological processes such as embryonic development, cell growth, morphogenesis, tissue repair, and tumor growth and invasion. Originally identified as a secreted factor with growth-stimulating effects on cultured glial cells, this protein is predominantly produced by neurons in the nervous system, suggesting its importance in glial cell development. The expression of the mouse homolog of FGF-9 is contingent on Sonic hedgehog (Shh) signaling, and its absence in mice led to a male-to-female sex reversal phenotype, indicating a role in testicular embryogenesis. Noteworthy is the biased expression of FGF-9, with elevated levels detected in the kidney (RPKM 6.4), adrenal (RPKM 2.1), and 10 other tissues, underscoring its potential significance in various physiological contexts across multiple organs.

Verified Bioactivity

Measured in a cell proliferation assay using Balb/c 3T3 mouse embryonic fibroblasts and the ED50 is typically 10-60 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 85%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-hFc
  • Accession

    NP_002001.1 (L4-S208)

  • Gene ID
    2254  [NCBI]
  • Molecular Construction
    • N-term
    • hFc
    • FGF-9 (L4-S208)
      Accession # NP_002001.1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF9; FGF-9; Fibroblast Growth Factor 9; GAF; Fibroblast Growth Factor 9 (Glia-Activating Factor); Fibroblast Growth Factor; Heparin-Binding Growth Factor 9; HBFG-9; Glia-Activating Factor; SYNS3; HBGF-9; FGF

  • AA Sequence

    LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

  • Predicted Molecular Mass

    54 kDa

  • Molecular Weight

    Approximately 54 kDa & 37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 85%, as determined by reducing SDS-PAGE.

  • FGF-9 Protein, Human (HEK293, Fc, solution) Product Image
    1/16
  • Experimental Validation Results for FGF-9 Protein, Human (HEK293, Fc, solution)
  • FGF-9 Protein, Human (HEK293, Fc, solution) Product Image