1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF family
  4. FGF
  5. FGF-9 Protein, Mouse (His)

FGF-9 Protein, Mouse (His)

Cat. No.: HY-P7352
Handling Instructions

FGF-9 Protein, Mouse (His) is a member of mouse fibroblast growth factors, Plays an important role in brain development and functions.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $460 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

FGF-9 Protein, Mouse (His) Featured Recommendations:

Top Publications Citing Use of Products

FGF-9 Protein, Mouse (His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P54130 (M1-S208)

Gene ID

14180

Synonyms
rMuFGF-9; FGF9; GAF; HBGF-9
AA Sequence

MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Weight

Approximately 26.0 kDa

Biological Activity
The ED50 is <5 ng/mL as measured by 3T3 cells, corresponding to a specific activity of >2 × 105 units/mg.
Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, 5% Trehalose, 1 mM EDTA, 20% glycerol, 1 mM DTT, pH 8.5.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

NA

Storage & Stability

Stored at -80°C. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

Fibroblast growth factors are important growth factors for physiological systems, and play critical and multifunctional roles during development, tumorigenesis, neuronal systems and disease progressions. FGF9 involves in neuronal disorders, plays an important role for brain development and functions[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-9 Protein, Mouse (His)
Cat. No.:
HY-P7352
Quantity:
MCE Japan Authorized Agent: