FGF-9 Protein, Mouse (His)

FGF-9 Protein, Mouse (His) is a member of mouse fibroblast growth factors, Plays an important role in brain development and functions.

Fibroblast growth factors are important growth factors for physiological systems, and play critical and multifunctional roles during development, tumorigenesis, neuronal systems and disease progressions. FGF9 involves in neuronal disorders, plays an important role for brain development and functions^[1].

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ is <7.4 ng/mL, corresponding to a specific activity of >1.3 × 10⁵ units/mg.

• 
  Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ is <7.4 ng/mL, corresponding to a specific activity of >1.3 × 10⁵ units/mg.

Mouse

E. coli

N-6*His

P54130 (M1-S208)

14180  [NCBI]

MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Approximately 26.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 5% Trehalose, 1 mM EDTA, 20% glycerol, 1 mM DTT, pH 8.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Yusuf IO, et al. Fibroblast Growth Factor 9 Suppresses Striatal Cell Death Dominantly Through ERK Signaling in Huntington's Disease. Cell Physiol Biochem. 2018;48(2):605-617.  [Content Brief]