1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-9
  6. FGF-9 Protein, Human

FGF-9 Protein, Human is a steroid-regulated mitogen and survival factor for nerve and mesenchymal cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE FGF-9 Protein, Human

2D/3D Cell Culture and Differentiation
Cell Proliferation/Viability Assay
WB
RT-PCR

    FGF-9 Protein, Human purchased from MCE. Usage Cited in: Cell Prolif. 2021 Jan;54(1):e12933.  [Abstract]

    Representative morphology of cultured THY‐1+ germ cell clumps after treatment for 7 days. The results showed that 20 ng/mL FGF-9 Protein, Human (FGF9) and 1 ng/mL FGF2 both induced larger colony formation in spermatogonial stem cells. Scale bar: 100 µm.

    FGF-9 Protein, Human purchased from MCE. Usage Cited in: Cell Prolif. 2021 Jan;54(1):e12933.  [Abstract]

    Effect of FGF-9 Protein, Human (FGF9) and FGF2 treatment on THY‐1+ germ cell number in culture. Cells were treated with GDNF, GFRα1 and listed concentration of FGF (n = 3).

    FGF-9 Protein, Human purchased from MCE. Usage Cited in: Cell Prolif. 2021 Jan;54(1):e12933.  [Abstract]

    Protein expressions of phosphorylated‐p38 MAPK and p38 MAPK in germ cells with different treatments. Germ cells were cultured with FGF-9 Protein, Human (FGF9, 40 ng/mL) for 2 d and protein was extracted for detection. The results showed that the phosphorylated p38 MAPK protein significantly increased with FGF9 treatment while the total amount of p38 MAPK did not change.

    FGF-9 Protein, Human purchased from MCE. Usage Cited in: Cell Prolif. 2021 Jan;54(1):e12933.  [Abstract]

    qPCR expression values of Bcl6b (n = 3). Starvation treatment: cells cultured in mSFM with no growth factors for 2 d. FGF-9 Protein, Human (FGF9) treatment: cells treated with mSFM containing 20 ng/mL of FGF9 for 2 d. Withdraw treatment: cells cultured in mSFM with no growth factors for 2 d. *P < .05, ANOVA.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    FGF-9 Protein, Human is a steroid-regulated mitogen and survival factor for nerve and mesenchymal cells.

    Background

    Fibroblast growth factor-9 (FGF-9) is a steroid-regulated mitogen and survival factor for nerve and mesenchymal cells. FGF-9, originally isolated from human glioma cells, has been found to be a potent mitogen and survival factor for numerous nerve cells, prostatic cells, and lung mesenchymal cells and is necessary for fetal testicular development[1].

    Biological Activity

    The ED50 is <20 ng/mL as measured by 3T3 cells, corresponding to a specific activity of >5.0 × 104 units/mg.

    • Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 this effect is 19.75 ng/mL, corresponding to a specific activity is 5.06×104 U/mg.
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P31371 (M1-S208)

    Gene ID
    Molecular Construction
    N-term
    FGF-9 (M1-S208)
    Accession # P31371
    C-term
    Protein Length

    Full Length

    Synonyms
    rHuFGF-9; GAF; HBGF-9
    AA Sequence

    MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

    Predicted Molecular Mass
    23.4 kDa
    Molecular Weight

    Approximately 23-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of PBS.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
    3.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, pH 8.0.
    4.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, 8% trehalose, pH 8.0.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <0.2 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    FGF-9 Protein, Human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    FGF-9 Protein, Human

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    FGF-9 Protein, Human
    Cat. No.:
    HY-P7177
    Quantity:
    MCE Japan Authorized Agent: