Copy Link Print Information

FGF-9 Protein, Human

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

FGF-9 Protein, Human is a steroid-regulated mitogen and survival factor for nerve and mesenchymal cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF-9 Protein, Human
  • Experimental Validation Results for FGF-9 Protein, Human
  • Experimental Validation Results for FGF-9 Protein, Human
  • Experimental Validation Results for FGF-9 Protein, Human
  • Experimental Validation Results for FGF-9 Protein, Human
  • Experimental Validation Results for FGF-9 Protein, Human
  • FGF-9 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-9 Protein, Human is a steroid-regulated mitogen and survival factor for nerve and mesenchymal cells.

Background

Fibroblast growth factor-9 (FGF-9) is a steroid-regulated mitogen and survival factor for nerve and mesenchymal cells. FGF-9, originally isolated from human glioma cells, has been found to be a potent mitogen and survival factor for numerous nerve cells, prostatic cells, and lung mesenchymal cells and is necessary for fetal testicular development[1].

Verified Bioactivity

Measured in a cell proliferation assay using Balb/3T3 cells. The ED50 for this effect is <20 ng/mL, corresponding to a specific activity is >5.0 × 104 units/mg.

Results
  • Experimental Validation Results for FGF-9 Protein, Human
    Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 this effect is 19.75 ng/mL, corresponding to a specific activity is 5.06×104 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P31371 (M1-S208)

  • Gene ID
    2254  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-9 (M1-S208)
      Accession # P31371
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    rHuFGF-9; GAF; HBGF-9

  • AA Sequence

    MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

  • Predicted Molecular Mass

    23.4 kDa

  • Molecular Weight

    Approximately 23-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for FGF-9 Protein, Human
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, pH 8.0.
4.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, 8% trehalose, pH 8.0.
5.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, pH 8.0, 8% trehalose, 0.2 mM PMSF.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Wing LY, et al. Expression and mitogenic effect of fibroblast growth factor-9 in human endometriotic implant is regulated by aberrant production of estrogen. J Clin Endocrinol Metab. 2003 Nov;88(11):5547-54. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 this effect is 19.75 ng/mL, corresponding to a specific activity is 5.06×104 U/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 this effect is 19.75 ng/mL, corresponding to a specific activity is 5.06×104 U/mg.

  • 1/16

    FGF-9 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Prolif. 2021 Jan;54(1):e12933. [Abstract]

    Customer Validation
     Representative morphology of cultured THY‐1+ germ cell clumps after treatment for 7 days. The results showed that 20 ng/mL FGF-9 Protein, Human (FGF9) and 1 ng/mL FGF2 both induced larger colony formation in spermatogonial stem cells. Scale bar: 100 µm.

  • 1/16

    FGF-9 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Prolif. 2021 Jan;54(1):e12933. [Abstract]

    Customer Validation
     Effect of FGF-9 Protein, Human (FGF9) and FGF2 treatment on THY‐1+ germ cell number in culture. Cells were treated with GDNF, GFRα1 and listed concentration of FGF (n = 3).

  • 1/16

    FGF-9 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Prolif. 2021 Jan;54(1):e12933. [Abstract]

    Customer Validation
     Protein expressions of phosphorylated‐p38 MAPK and p38 MAPK in germ cells with different treatments. Germ cells were cultured with FGF-9 Protein, Human (FGF9, 40 ng/mL) for 2 d and protein was extracted for detection. The results showed that the phosphorylated p38 MAPK protein significantly increased with FGF9 treatment while the total amount of p38 MAPK did not change.

  • 1/16

    FGF-9 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Prolif. 2021 Jan;54(1):e12933. [Abstract]

    Customer Validation
     qPCR expression values of Bcl6b (n = 3). Starvation treatment: cells cultured in mSFM with no growth factors for 2 d. FGF-9 Protein, Human (FGF9) treatment: cells treated with mSFM containing 20 ng/mL of FGF9 for 2 d. Withdraw treatment: cells cultured in mSFM with no growth factors for 2 d. *P < .05, ANOVA.

  • FGF-9 Protein, Human Product Image
    1/16
  • Experimental Validation Results for FGF-9 Protein, Human
  • Experimental Validation Results for FGF-9 Protein, Human
  • Experimental Validation Results for FGF-9 Protein, Human
  • Experimental Validation Results for FGF-9 Protein, Human
  • Experimental Validation Results for FGF-9 Protein, Human
  • Experimental Validation Results for FGF-9 Protein, Human
  • FGF-9 Protein, Human Product Image

  • FGF-9 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Prolif. 2021 Jan;54(1):e12933. [Abstract]

    Representative morphology of cultured THY‐1+ germ cell clumps after treatment for 7 days. The results showed that 20 ng/mL FGF-9 Protein, Human (FGF9) and 1 ng/mL FGF2 both induced larger colony formation in spermatogonial stem cells. Scale bar: 100 µm.

  • FGF-9 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Prolif. 2021 Jan;54(1):e12933. [Abstract]

    Effect of FGF-9 Protein, Human (FGF9) and FGF2 treatment on THY‐1+ germ cell number in culture. Cells were treated with GDNF, GFRα1 and listed concentration of FGF (n = 3).

  • FGF-9 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Prolif. 2021 Jan;54(1):e12933. [Abstract]

    Protein expressions of phosphorylated‐p38 MAPK and p38 MAPK in germ cells with different treatments. Germ cells were cultured with FGF-9 Protein, Human (FGF9, 40 ng/mL) for 2 d and protein was extracted for detection. The results showed that the phosphorylated p38 MAPK protein significantly increased with FGF9 treatment while the total amount of p38 MAPK did not change.

  • FGF-9 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Prolif. 2021 Jan;54(1):e12933. [Abstract]

    qPCR expression values of Bcl6b (n = 3). Starvation treatment: cells cultured in mSFM with no growth factors for 2 d. FGF-9 Protein, Human (FGF9) treatment: cells treated with mSFM containing 20 ng/mL of FGF9 for 2 d. Withdraw treatment: cells cultured in mSFM with no growth factors for 2 d. *P < .05, ANOVA.