FGF-8b Protein, Human/Mouse

1.Measured in a cell proliferation assay using BALB/c 3T3 cells and the special bioactivity is 12-40.58 ng/mL.
2.Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED₅₀ for this effect is typically 51.21 ng/mL in the presence of 1 µg/mL heparin,corresponding to a specific activity is 1.95×10⁴ U/mg.

• 
  Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED₅₀ for this effect is typically 51.21 ng/mL in the presence of 1 µg/mL heparin,corresponding to a specific activity is 1.95×10^4 U/mg.

Mouse; Human

E. coli

Tag Free

P55075-3/P37237-2 (Q23-R215)

2253  [NCBI]/14179  [NCBI]

QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

21-24 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4 or 20 mM PB,300 mM NaCl,2% Sucrose, 0.02% Tween 80,pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.