1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-8
  6. FGF-8b Protein, Human/Mouse

FGF-8b Protein, Human/Mouse is the recombinant mouse, human-derived FGF-8b protein, expressed by E. coli, with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-8b Protein, Human/Mouse is the recombinant mouse, human-derived FGF-8b protein, expressed by E. coli, with tag free.

Background

FGF-8b plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation, and cell migration. It is required for normal brain, eye, ear, and limb development during embryogenesis. Additionally, FGF-8b is essential for the normal development of the gonadotropin-releasing hormone (GnRH) neuronal system (by similar: PubMed:16384934, PubMed:16597617, PubMed:8663044). It also functions in neurite outgrowth in hippocampal cells (by similar: PubMed:21576111).

Biological Activity

1.Measured in a cell proliferation assay using BALB/c 3T3 cells and the special bioactivity is ≤40.58 ng/mL.
2.Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED50 for this effect is typically 10-60 ng/mL in the presence of 1 µg/mL heparin.

  • Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED50 for this effect is typically 51.21 ng/mL in the presence of 1 µg/mL heparin, corresponding to a specific activity is 1.95×10^4 U/mg.
Species

Human; Mouse

Source

E. coli

Tag

Tag Free

Accession

P55075-3/P37237-2 (Q23-R215)

Gene ID
Molecular Construction
N-term
FGF-8b (Q23-R215)
Accession # P55075-3
C-term
Protein Length

Partial

Synonyms
Fibroblast growth factor 8; Androgen-induced growth factor; Heparin-binding growth factor 8; AIGF; HBGF-8; FGF-8B
AA Sequence

QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Predicted Molecular Mass
22.5 kDa
Molecular Weight

Approximately 22-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, 2% sucrose, 0.02% Tween 80, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-8b Protein, Human/Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGF-8b Protein, Human/Mouse

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-8b Protein, Human/Mouse
Cat. No.:
HY-P70533
Quantity:
MCE Japan Authorized Agent: