1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. BMP-7
  6. BMP-7 Protein, Human

BMP-7 Protein, Human

Cat. No.: HY-P7008
Handling Instructions

BMP-7 Protein, Human is a member of the BMP-family, and a part of the transforming growth factor (TGF-β) superfamily, used for revision posterolateral lumbar spine fusion and for the treatment of long bone nonunion fractures after successful clinical trials.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $280 In-stock
Estimated Time of Arrival: December 31
50 μg $840 In-stock
Estimated Time of Arrival: December 31
100 μg $1500 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

BMP-7 Protein, Human is a member of the BMP-family, and a part of the transforming growth factor (TGF-β) superfamily, used for revision posterolateral lumbar spine fusion and for the treatment of long bone nonunion fractures after successful clinical trials.

Background

Bone morphogenetic protein-7 (BMP-7) is a homodimeric glycoprotein that belongs to the transforming growth factor beta (TGFβ) superfamily, functions in osteogenesis and chondrogenesis, and is involved in various cellular processes such as kidney and eye development, brown adipogenesis, and bone metastasis. Recombinant Human Bone Morphogenetic Protein 7 produced in Chinese hamster ovary (CHO) cells is approved for revision posterolateral lumbar spine fusion and for the treatment of long bone nonunion fractures after successful clinical trials[1].

Biological Activity
Data is not available.
Species

Human

Source

E. coli

Accession

P18075 (S293-P431)

Gene ID
Synonyms
rHuBMP-7; OP-1
AA Sequence

STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH

Molecular Weight

Approximately 15.7 kDa

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 30% acetonitrile, 0.1% TFA.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 10mM HAc.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMP-7 Protein, Human
Cat. No.:
HY-P7008
Quantity:
MCE Japan Authorized Agent: