(Glu13,17,20)-Osteocalcin (1-46) (mouse)
Based on 1 Customer Validation
(Glu13,17,20)-Osteocalcin (1-46) (mouse) is an analogue of Osteocalcin (1-46). Osteocalcin (1-46) is a osteoblast specific peptide involved in the regulation of energy metabolism.
For research use only. We do not sell to patients.
- Purity : 97.06%
- CAS No.: 1802086-27-6
- Formula: C226H351N57O74S2
- Molecular Weight:5114.67
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
Chemical Information
-
CAS No. 1802086-27-6
-
Appearance Solid
-
Molecular Weight 5114.67
-
Formula C226H351N57O74S2
-
Color White to off-white
-
Sequence
Tyr-Leu-Gly-Ala-Ser-Val-Pro-Ser-Pro-Asp-Pro-Leu-Glu-Pro-Thr-Arg-Glu-Gln-Cys-Glu-Leu-Asn-Pro-Ala-Cys-Asp-Glu-Leu-Ser-Asp-Gln-Tyr-Gly-Leu-Lys-Thr-Ala-Tyr-Lys-Arg-Ile-Tyr-Gly-Ile-Thr-Ile (Disulfide bridge: Cys19-Cys25)
-
Sequence Shortening
YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI (Disulfide bridge: Cys19-Cys25)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
DMSO : ≥ 100 mg/mL (19.55 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (268 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.1955 mL | 0.9776 mL | 1.9552 mL | 4.8879 mL |
| 5 mM | 0.0391 mL | 0.1955 mL | 0.3910 mL | 0.9776 mL | |
| 10 mM | 0.0196 mL | 0.0978 mL | 0.1955 mL | 0.4888 mL | |
| 15 mM | 0.0130 mL | 0.0652 mL | 0.1303 mL | 0.3259 mL |