14-3-3 epsilon Protein, Mouse (His)
Based on 1 Customer Validation
14-3-3 epsilon proteins are adapter proteins in various signaling pathways that bind to phosphoserine or phosphothreonine motifs to regulate chaperone activity.It positively regulates HSF1 nuclear export to the cytoplasm, forming homo- and heterodimers with YWHAZ.14-3-3 epsilon Protein, Mouse (His) is the recombinant mouse-derived 14-3-3 epsilon protein, expressed by E.coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
14-3-3 epsilon proteins are adapter proteins in various signaling pathways that bind to phosphoserine or phosphothreonine motifs to regulate chaperone activity.It positively regulates HSF1 nuclear export to the cytoplasm, forming homo- and heterodimers with YWHAZ.14-3-3 epsilon Protein, Mouse (His) is the recombinant mouse-derived 14-3-3 epsilon protein, expressed by E.coli , with N-6*His labeled tag.
Background
The 14-3-3 epsilon protein serves as an adapter implicated in the regulation of a diverse array of both general and specialized signaling pathways, binding to numerous partners through the recognition of phosphoserine or phosphothreonine motifs, thereby modulating the activity of the binding partner. Notably, it positively regulates the nuclear export of phosphorylated protein HSF1 to the cytoplasm. Existing as a homodimer, it also forms heterodimers with YWHAZ and interacts with various proteins, including PKA-phosphorylated AANAT, ABL1 in its phosphorylated form, ARHGEF28, BEX3, CDKN1B, the 'Thr-369' phosphorylated form of DAPK2, DENND1A, GAB2, phosphorylated GRB10, KSR1, NDEL1, PI4KB, TBC1D22A, TBC1D22B, the phosphorylated form of SRPK2, TIAM2, the 'Ser-1134' and 'Ser-1161' phosphorylated form of SOS1, ZFP36, SLITRK1, HSF1 in its phosphorylated form, RIPOR2, KLHL22, CRTC1, CRTC2 (probably when phosphorylated at 'Ser-171'), CRTC3 (probably when phosphorylated at 'Ser-162' and/or 'Ser-273'), ATP2B1, ATP2B3, and MEFV. These interactions highlight the multifaceted role of 14-3-3 epsilon in orchestrating various cellular processes and signaling events.
Verified Bioactivity
Immobilized Mouse 14-3-3 epsilon at 2 μg/mL (100 μL/well) can bind Anti-14-3-3 epsilon Antibody. The ED50 for this effect is 0.2259 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P62259 (M1-Q255)
-
Molecular Construction
-
N-term
-
6*His
-
14-3-3E (M1-Q255)
Accession # P62259 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
YWHAE; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein Epsilon; 14-3-3 Protein Epsilon; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; Epsilon Polypeptide; 14-3-3 Epsilon; FLJ45465; 14-3-3E; Tyrosine 3/Trypt
-
AA Sequence
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
-
Predicted Molecular Mass
29.2 kDa
-
Molecular Weight
Approximately 31 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
