14-3-3 zeta Protein, Human
14-3-3 zeta Protein, Human is the recombinant human-derived 14-3-3 zeta, expressed by E. coli, with tag free labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
14-3-3 zeta Protein, Human is the recombinant human-derived 14-3-3 zeta, expressed by E. coli, with tag free labeled tag.
Background
14-3-3 zeta is an adapter protein involved in regulating a broad spectrum of general and specialized signaling pathways. It binds to numerous partner proteins, typically by recognizing phosphoserine or phosphothreonine motifs, often resulting in modulation of the partner's activity. This protein promotes cytoplasmic retention and inactivation of the TFEB transcription factor by binding to phosphorylated TFEB. Additionally, it enhances ARHGEF7 activity on RAC1 and facilitates lamellipodia and membrane ruffle formation. In neurons, 14-3-3 zeta regulates spine maturation through modulation of ARHGEF7 activity (By similar).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P63104-1 (M1-N245)
-
Gene ID7534
-
Protein Length
Full Length of Isoform-1
-
Synonyms
YWHAZ; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein Zeta; YWHAD; KCIP-1; 14-3-3-Zeta; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; Delta Polypeptide; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase
-
AA Sequence
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
