2. Recombinant Proteins
  3. Others
  4. 14-3-3 zeta Protein, Human

14-3-3 zeta Protein, Human is the recombinant human-derived 14-3-3 zeta, expressed by E. coli, with tag free labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
20 μg 견적 받기
100 μg 견적 받기

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

14-3-3 zeta Protein, Human is the recombinant human-derived 14-3-3 zeta, expressed by E. coli, with tag free labeled tag.
Background

14-3-3 zeta is an adapter protein involved in regulating a broad spectrum of general and specialized signaling pathways. It binds to numerous partner proteins, typically by recognizing phosphoserine or phosphothreonine motifs, often resulting in modulation of the partner's activity. This protein promotes cytoplasmic retention and inactivation of the TFEB transcription factor by binding to phosphorylated TFEB. Additionally, it enhances ARHGEF7 activity on RAC1 and facilitates lamellipodia and membrane ruffle formation. In neurons, 14-3-3 zeta regulates spine maturation through modulation of ARHGEF7 activity (By similar).
Species

Human
Source

E. coli
Tag

Tag Free
Accession

P63104-1 (M1-N245)
Gene ID

7534
Protein Length

Full Length of Isoform-1
Synonyms
14-3-3 zeta; YWHAZ; KCIP-1; MGC111427; MGC126532; MGC138156
AA Sequence

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Predicted Molecular Mass
29 kDa
Purity

≥ 80%, as determined by reducing SDS-PAGE.
각종 서류
Handling Instructions (2659 KB)

14-3-3 zeta Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

14-3-3 zeta Protein, Human

  

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

도

Country or Region *

      

비고

대량구매 문의

Inquiry Information

상품명:
14-3-3 zeta Protein, Human
Cat. No.:
HY-P702997
수량:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

상품명

  

Lot #

고객명 *

 

Country or Region *

메일주소 *

     

전화번호 *

 

회사명 *

비고

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.