4-1BB/TNFRSF9 Protein, Rat (HEK293, His)
4-1BB/TNFRSF9 protein is deficient in the conserved residue(s) necessary for propagating feature annotation. 4-1BB/TNFRSF9 Protein, Rat (HEK293, His) is the recombinant rat-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-His labeled tag. The total length of 4-1BB/TNFRSF9 Protein, Rat (HEK293, His) is 164 a.a., with molecular weight of 28-38 kDa.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
4-1BB/TNFRSF9 protein is deficient in the conserved residue(s) necessary for propagating feature annotation. 4-1BB/TNFRSF9 Protein, Rat (HEK293, His) is the recombinant rat-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-His labeled tag. The total length of 4-1BB/TNFRSF9 Protein, Rat (HEK293, His) is 164 a.a., with molecular weight of 28-38 kDa.
Background
4-1BB (Tumor Necrosis Factor Receptor Superfamily Member 9/TNFRSF9) is a cell surface receptor belonging to the TNF receptor superfamily. Primarily expressed on activated T cells, it plays a key role in immune responses. Upon binding to its ligand, 4-1BBL, it activates signaling pathways that enhance T cell proliferation and survival.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
Q4W8J3 (T24-Q187)
-
Gene ID/
-
Molecular Construction
-
N-term
-
4-1BB (T24-Q187)
Accession # Q4W8J3 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TNFRSF9; CDw137; Prev. ILA; Tumor Necrosis Factor Receptor Superfamily, Member 9; CD137; Induced By Lymphocyte Activation (ILA); 4-1BB; Homolog Of Mouse 4-1BB; Tumor Necrosis Factor Receptor Superfamily Member 9; Receptor Protein 4-1BB; T-Cell Antigen 4-1
-
AA Sequence
TRNPCDSCEAGTFCSKYPPVCTSCPPSTYSSTGGQPNCDICRVCQGYFRFKKPCSSTHNAECECVEGFHCLGPKCTRCEKDCRPGQELTEQGCKNCGLGTFNDQDGAGVCRPWTNCSLDGRSVLKNGTKEKDVVCGPPVVSLSPSTTPSAVTTPERESGERPLQ
-
Predicted Molecular Mass
19.5 kDa
-
Molecular Weight
Approximately 28-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
