AADAC Protein, Human (His)
Based on 1 Customer Validation
AADAC Protein, Human (His) is the recombinant human-derived AADAC protein, expressed by E. coli, with N-10*His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
AADAC Protein, Human (His) is the recombinant human-derived AADAC protein, expressed by E. coli, with N-10*His tag.
AADAC exhibits cellular triglyceride lipase activity in the liver, increasing intracellular fatty acid levels derived from the hydrolysis of newly formed triglyceride stores and playing a role in very low-density lipoprotein (VLDL) assembly. Additionally, AADAC displays serine esterase activity in the liver, deacetylating various arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them into primary arylamide compounds and enhancing their toxicity.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His
-
Accession
P22760 (P24-L399)
-
Gene ID13
-
Molecular Construction
-
N-term
-
10*His
-
AADAC (P24-L399)
Accession # P22760 -
C-term
-
-
Protein Length
Partial
-
Synonyms
AADAC; CES5A1; Arylacetamide Deacetylase; Arylacetamide Deacetylase (Esterase); DAC
-
AA Sequence
PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL
-
Predicted Molecular Mass
49.1 kDa
-
Molecular Weight
Approximately 49 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
