ACE2 Protein, Human (Biotinylated, 594a.a, HEK293, His-Avi)

The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2, Human (Biotinylated, 594a.a, HEK293, His-Avi) is the recombinant human-derived ACE2 protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2, Human (Biotinylated, 594a.a, HEK293, His-Avi) is the recombinant human-derived ACE2 protein, expressed by HEK293, with C-His labeled tag.

Background

ACE2, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. Through its enzymatic activity, ACE2 converts angiotensin I to angiotensin 1-9 and angiotensin II to angiotensin 1-7, exerting anti-hypertrophic effects in cardiomyocytes and acting as a vasodilator with anti-proliferative properties. Beyond its central role in the renin-angiotensin system, ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. Notably, ACE2's C-terminus, homologous to collectrin, orchestrates the trafficking of the neutral amino acid transporter SL6A19 to the gut epithelial cell membrane, thereby regulating its surface expression and catalytic activity. Importantly, ACE2 also serves as a receptor for human coronaviruses SARS-CoV, SARS-CoV-2, and HCoV-NL63, implicating it in microbial infection pathways.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ACE2 (Q18-S611)
      Accession # Q9BYF1-1
    • His
    • Avi
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    ACE2; Angiotensin I Converting Enzyme 2; Angiotensin Converting Enzyme 2; Angiotensin-Converting Enzyme 2; ACEH; ACE-Related Carboxypeptidase; Angiotensin I Converting Enzyme (Peptidyl-Dipeptidase A) 2; Metalloprotease MPROT15; Angiotensin-Converting Enzy

  • AA Sequence

    QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWS

  • Predicted Molecular Mass

    72.3 kDa

  • Molecular Weight

    Approximately 90-110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00