Activin E Protein, Human (His)
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P58166 (T237-S350)
-
Gene ID83729
-
Molecular Construction
-
N-term
-
His
-
Activin E (T237-S350)
Accession # P58166 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
INHBE; Activin; Inhibin Subunit Beta E; MGC4638; Inhibin Beta E Chain; Inhibin Beta E Subunit; Activin Beta-E Chain; Inhibin, Beta E
-
AA Sequence
TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
-
Predicted Molecular Mass
14.5 kDa
-
Molecular Weight
Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)