ACYP1 Protein, Human (His)
ACYP1 Protein, Human (His) is human recombinant Acylphosphatase-1 (ACYP1) with an N-terminal His tag. Recombinant Human Acylphosphatase-1, His is expressed in E. coli.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
ACYP1 Protein, Human (His) is human recombinant Acylphosphatase-1 (ACYP1) with an N-terminal His tag. Recombinant Human Acylphosphatase-1, His is expressed in E. coli.
Acylphosphatase-1 (ACYP1) is a small cytosolic enzyme which catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Acylphosphatase is widely distributed in human in two isoenzymatic forms, named ACYP1 and ACYP2. Human ACYP1 gene spans about 10 Kbp and contains two exons of 84 bp and 123 bp. The classic intron-exon junction signal sequences and the polyadenilation site at the end of the gene are present[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P07311 (M1-K99)
-
Molecular Construction
-
N-term
-
6*His
-
ACYP1 (M1-K99)
Accession # P07311 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ACYP1; Acylphosphate Phosphohydrolase 1; Acylphosphatase 1; Acylphosphatase-1; Acylphosphatase 1, Erythrocyte (Common) Type; ACYPE; Acylphosphatase, Organ-Common Type Isozyme; Acylphosphatase; Acylphosphatase, Erythrocyte Isozyme
-
AA Sequence
MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
-
Predicted Molecular Mass
13.4 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
