1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. ACYP1 Protein, Human (His)

ACYP1 Protein, Human (His)

Cat. No.: HY-P7458
Handling Instructions

ACYP1 Protein, Human (His) is human recombinant Acylphosphatase-1 (ACYP1) with an N-terminal His tag. Recombinant Human Acylphosphatase-1, His is expressed in E. coli.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $75 Ask For Quote & Lead Time
50 μg $210 Ask For Quote & Lead Time

* Please select Quantity before adding items.

ACYP1 Protein, Human (His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

N-His

Accession

P07311 (M1-K99)

Gene ID

97

Synonyms
rHuAcylphosphatase-1, His; ACYP-1; Acylphosphatase 1
AA Sequence

HHHHHHMAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK

Molecular Weight

Approximately 14.0 kDa

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 20 mM Tris, 100 mM NaCl, 1 mM DTT, 20% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

Acylphosphatase-1 (ACYP1) is a small cytosolic enzyme which catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Acylphosphatase is widely distributed in human in two isoenzymatic forms, named ACYP1 and ACYP2. Human ACYP1 gene spans about 10 Kbp and contains two exons of 84 bp and 123 bp. The classic intron-exon junction signal sequences and the polyadenilation site at the end of the gene are present[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ACYP1 Protein, Human (His)
Cat. No.:
HY-P7458
Quantity:
MCE Japan Authorized Agent: