ADAM15 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

ADAM15 protein is an active metalloprotease involved in wound healing, cell interactions, and T cell recruitment. It inhibits airway smooth muscle cell adhesion and migration mediated by beta-1 integrin. ADAM15 Protein, Human (HEK293, His) is the recombinant human-derived ADAM15 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ADAM15 protein is an active metalloprotease involved in wound healing, cell interactions, and T cell recruitment. It inhibits airway smooth muscle cell adhesion and migration mediated by beta-1 integrin. ADAM15 Protein, Human (HEK293, His) is the recombinant human-derived ADAM15 protein, expressed by HEK293 , with C-His labeled tag.

Background

ADAM15 protein is an active metalloproteinase that possesses gelatinolytic and collagenolytic activity. It is involved in various biological processes, including wound healing, heterotypic intraepithelial cell/T-cell interactions, and homotypic T-cell aggregation. ADAM15 also inhibits the adhesion and migration of airway smooth muscle cells mediated by beta-1 integrin. It suppresses cell motility towards fibronectin, potentially by reducing the expression of alpha-v/beta-1 integrin through the inactivation of ERK1/2. Additionally, ADAM15 cleaves E-cadherin in response to growth factor deprivation and plays a role in glomerular cell migration and pathological neovascularization. It may also have a role in cartilage remodeling. During sperm epididymal maturation and the acrosome reaction, ADAM15 may undergo proteolytic processing. Its disintegrin domain suggests a potential involvement in sperm-egg binding.

Verified Bioactivity

Measured by its ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 0.9505 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 0.9505 μg/mL, corresponding to a specific activity is 1052.078 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ADAM15 (D207-T696)
      Accession # Q13444
    • 10*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    ADAM15; A Disintegrin And Metalloproteinase Domain 15 (Metargidin); ADAM Metallopeptidase Domain 15; Metalloprotease RGD Disintegrin Protein; MDC15; Metargidin; Metalloproteinase-Like, Disintegrin-Like, And Cysteine-Rich Protein 15; MDC-15; Disintegrin An

  • AA Sequence

    DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGDCDLPEFCPGDSSQCPPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSKCHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSSLTT

  • Predicted Molecular Mass

    52.4 kDa

  • Molecular Weight

    Approximately 65-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00