ADAM15 Protein, Human (HEK293, His)
Based on 1 Customer Validation
ADAM15 protein is an active metalloprotease involved in wound healing, cell interactions, and T cell recruitment. It inhibits airway smooth muscle cell adhesion and migration mediated by beta-1 integrin. ADAM15 Protein, Human (HEK293, His) is the recombinant human-derived ADAM15 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ADAM15 protein is an active metalloprotease involved in wound healing, cell interactions, and T cell recruitment. It inhibits airway smooth muscle cell adhesion and migration mediated by beta-1 integrin. ADAM15 Protein, Human (HEK293, His) is the recombinant human-derived ADAM15 protein, expressed by HEK293 , with C-His labeled tag.
Background
ADAM15 protein is an active metalloproteinase that possesses gelatinolytic and collagenolytic activity. It is involved in various biological processes, including wound healing, heterotypic intraepithelial cell/T-cell interactions, and homotypic T-cell aggregation. ADAM15 also inhibits the adhesion and migration of airway smooth muscle cells mediated by beta-1 integrin. It suppresses cell motility towards fibronectin, potentially by reducing the expression of alpha-v/beta-1 integrin through the inactivation of ERK1/2. Additionally, ADAM15 cleaves E-cadherin in response to growth factor deprivation and plays a role in glomerular cell migration and pathological neovascularization. It may also have a role in cartilage remodeling. During sperm epididymal maturation and the acrosome reaction, ADAM15 may undergo proteolytic processing. Its disintegrin domain suggests a potential involvement in sperm-egg binding.
Verified Bioactivity
Measured by its ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 0.9505 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
Q13444 (D207-T696)
-
Gene ID8751
-
Molecular Construction
-
N-term
-
ADAM15 (D207-T696)
Accession # Q13444 -
10*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ADAM15; A Disintegrin And Metalloproteinase Domain 15 (Metargidin); ADAM Metallopeptidase Domain 15; Metalloprotease RGD Disintegrin Protein; MDC15; Metargidin; Metalloproteinase-Like, Disintegrin-Like, And Cysteine-Rich Protein 15; MDC-15; Disintegrin An
-
AA Sequence
DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGDCDLPEFCPGDSSQCPPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSKCHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSSLTT
-
Predicted Molecular Mass
52.4 kDa
-
Molecular Weight
Approximately 65-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)