1. Recombinant Proteins
  2. Enzymes & Regulators
  3. ADAMs/ADAMTSs
  4. ADAMTSL-1/Punctin-1
  5. ADAMTSL1/Punctin Protein, Human (sf9, His)

ADAMTSL1/Punctin Protein, a member of the ADAMTS family, encodes a unique secreted protein lacking metalloproteinase and disintegrin-like domains but retaining other ADAMTS domains, including the thrombospondin type 1 motif. Likely involved in crucial extracellular matrix functions, alternative splicing generates multiple transcript variants, each encoding distinct proteins. ADAMTSL1/Punctin Protein, Human (sf9, His) is the recombinant human-derived ADAMTSL1/Punctin protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ADAMTSL1/Punctin Protein, a member of the ADAMTS family, encodes a unique secreted protein lacking metalloproteinase and disintegrin-like domains but retaining other ADAMTS domains, including the thrombospondin type 1 motif. Likely involved in crucial extracellular matrix functions, alternative splicing generates multiple transcript variants, each encoding distinct proteins. ADAMTSL1/Punctin Protein, Human (sf9, His) is the recombinant human-derived ADAMTSL1/Punctin protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

ADAMTSL1, a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family, encodes a secreted protein. In contrast to typical ADAMTS family members, this protein lacks the metalloproteinase and disintegrin-like domains but retains other ADAMTS domains, including the thrombospondin type 1 motif. The protein is likely involved in crucial functions within the extracellular matrix. Alternative splicing generates multiple transcript variants, each encoding distinct proteins.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q8N6G6-2 (E29-H439)

Gene ID
Molecular Construction
N-term
ADAMTSL1 (E29-H439)
Accession # Q8N6G6-2
His
C-term
Protein Length

Partial

Synonyms
ADAMTS-like protein 1; ADAMTSL-1; Punctin-1; ADAMTSR1; C9orf94
AA Sequence

EEDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCPARWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDCPKWLAQEWSPVTVPSFFVH

Predicted Molecular Mass
47.1 kDa
Molecular Weight

Approximately 48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ADAMTSL1/Punctin Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ADAMTSL1/Punctin Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ADAMTSL1/Punctin Protein, Human (sf9, His)
Cat. No.:
HY-P76135
Quantity:
MCE Japan Authorized Agent: