ADAMTSL1/Punctin Protein, Human (sf9, His)

Customer Review

Based on 1 Customer Validation

ADAMTSL1/Punctin Protein, a member of the ADAMTS family, encodes a unique secreted protein lacking metalloproteinase and disintegrin-like domains but retaining other ADAMTS domains, including the thrombospondin type 1 motif. Likely involved in crucial extracellular matrix functions, alternative splicing generates multiple transcript variants, each encoding distinct proteins. ADAMTSL1/Punctin Protein, Human (sf9, His) is the recombinant human-derived ADAMTSL1/Punctin protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ADAMTSL1/Punctin Protein, a member of the ADAMTS family, encodes a unique secreted protein lacking metalloproteinase and disintegrin-like domains but retaining other ADAMTS domains, including the thrombospondin type 1 motif. Likely involved in crucial extracellular matrix functions, alternative splicing generates multiple transcript variants, each encoding distinct proteins. ADAMTSL1/Punctin Protein, Human (sf9, His) is the recombinant human-derived ADAMTSL1/Punctin protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

ADAMTSL1, a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family, encodes a secreted protein. In contrast to typical ADAMTS family members, this protein lacks the metalloproteinase and disintegrin-like domains but retains other ADAMTS domains, including the thrombospondin type 1 motif. The protein is likely involved in crucial functions within the extracellular matrix. Alternative splicing generates multiple transcript variants, each encoding distinct proteins.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ADAMTSL1 (E29-H439)
      Accession # Q8N6G6-2
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    ADAMTSL1; ADAMTSL-1; Prev. C9orf94; Punctin; Punctin-1; Chromosome 9 Open Reading Frame 94; ADAMTSR1; ADAM-TS Related Protein 1; ADAMTS-Like Protein 1; ADAMTS Like 1; FLJ35283

  • AA Sequence

    EEDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCPARWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDCPKWLAQEWSPVTVPSFFVH

  • Predicted Molecular Mass

    47.1 kDa

  • Molecular Weight

    Approximately 48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00