ADAMTSL1/Punctin Protein, Human (sf9, His)
Based on 1 Customer Validation
ADAMTSL1/Punctin Protein, a member of the ADAMTS family, encodes a unique secreted protein lacking metalloproteinase and disintegrin-like domains but retaining other ADAMTS domains, including the thrombospondin type 1 motif. Likely involved in crucial extracellular matrix functions, alternative splicing generates multiple transcript variants, each encoding distinct proteins. ADAMTSL1/Punctin Protein, Human (sf9, His) is the recombinant human-derived ADAMTSL1/Punctin protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ADAMTSL1/Punctin Protein, a member of the ADAMTS family, encodes a unique secreted protein lacking metalloproteinase and disintegrin-like domains but retaining other ADAMTS domains, including the thrombospondin type 1 motif. Likely involved in crucial extracellular matrix functions, alternative splicing generates multiple transcript variants, each encoding distinct proteins. ADAMTSL1/Punctin Protein, Human (sf9, His) is the recombinant human-derived ADAMTSL1/Punctin protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
ADAMTSL1, a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family, encodes a secreted protein. In contrast to typical ADAMTS family members, this protein lacks the metalloproteinase and disintegrin-like domains but retains other ADAMTS domains, including the thrombospondin type 1 motif. The protein is likely involved in crucial functions within the extracellular matrix. Alternative splicing generates multiple transcript variants, each encoding distinct proteins.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q8N6G6-2 (E29-H439)
-
Molecular Construction
-
N-term
-
ADAMTSL1 (E29-H439)
Accession # Q8N6G6-2 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
ADAMTSL1; ADAMTSL-1; Prev. C9orf94; Punctin; Punctin-1; Chromosome 9 Open Reading Frame 94; ADAMTSR1; ADAM-TS Related Protein 1; ADAMTS-Like Protein 1; ADAMTS Like 1; FLJ35283
-
AA Sequence
EEDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPYGSRHIRLVLKGPDHLYLETKTLQGTKGENSLSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRNSGSADSTVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCPARWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDCPKWLAQEWSPVTVPSFFVH
-
Predicted Molecular Mass
47.1 kDa
-
Molecular Weight
Approximately 48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
