1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. ADH Protein, Drosophila melanogaster (His, StrepⅡ)

ADH Protein, Drosophila melanogaster (His, StrepⅡ)

Cat. No.: HY-P701939
Handling Instructions Technical Support

ADH Protein, Drosophila melanogaster (S2-I256) is a dimeric Zn-containing enzyme in the oxidoreductase family with acetaldehyde dehydrogenase and alcohol dehydrogenase activity, therefore, can oxidize primary and secondary alcohols. ADH Protein, Drosophila melanogaster (S2-I256) is E.coli-sourced and tag-free, the initiator methionine is naturally removed. ADH Protein, Drosophila melanogaster (His, Strep) is the recombinant ADH protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

ADH Protein, Drosophila melanogaster (S2-I256) is a dimeric Zn-containing enzyme in the oxidoreductase family with acetaldehyde dehydrogenase and alcohol dehydrogenase activity, therefore, can oxidize primary and secondary alcohols. ADH Protein, Drosophila melanogaster (S2-I256) is E.coli-sourced and tag-free, the initiator methionine is naturally removed. ADH Protein, Drosophila melanogaster (His, Strep) is the recombinant ADH protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

Background

Alcohol dehydrogenase proteins (ADHs) are a group of dimeric Zn-containing enzymes in the oxidoreductase family, ADHs have acetaldehyde dehydrogenase (acetylating) and alcohol dehydrogenase (NAD+) activity, enabling ADHs to oxidize the [CH-OH] group of primary or secondary alcohols using NAD+ or NADP+ as the electron acceptor. ADHs are located in cytosol and part of protein-containing complex. ADHs are expressed mainly in liver, and also exist in other structures, including circulatory system, digestive system, extended germ band embryo, fat body; and reproductive system. ADHs are up-regulated by retinoic acid, growth hormone and glucocorticoids while being down-regulated by androgens and thyroid hormone[1][2][3].

Species

Others

Source

E. coli

Tag

N-StrepⅡ;N-6*His

Accession

P00334 (S2-I256)

Gene ID

3771877

Molecular Construction
N-term
StrepⅡ-6*His
ADH (S2-I256)
Accession # P00334
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Adh; Alcohol dehydrogenase
AA Sequence

SFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLVHKFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLGTLEAIQWTKHWDSGI

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

ADH Protein, Drosophila melanogaster (His, StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ADH Protein, Drosophila melanogaster (His, StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ADH Protein, Drosophila melanogaster (His, StrepⅡ)
Cat. No.:
HY-P701939
Quantity:
MCE Japan Authorized Agent: