ADH Protein, Drosophila melanogaster

Customer Review

Based on 1 Customer Validation

ADH Protein, Drosophila melanogaster (S2-I256) is a dimeric Zn-containing enzyme in the oxidoreductase family with acetaldehyde dehydrogenase and alcohol dehydrogenase activity, therefore, can oxidize primary and secondary alcohols. ADH Protein, Drosophila melanogaster (S2-I256) is E.coli-sourced and tag-free, the initiator methionine is naturally removed. ADH Protein, Drosophila melanogaster is the recombinant ADH protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ADH Protein, Drosophila melanogaster (S2-I256) is a dimeric Zn-containing enzyme in the oxidoreductase family with acetaldehyde dehydrogenase and alcohol dehydrogenase activity, therefore, can oxidize primary and secondary alcohols. ADH Protein, Drosophila melanogaster (S2-I256) is E.coli-sourced and tag-free, the initiator methionine is naturally removed. ADH Protein, Drosophila melanogaster is the recombinant ADH protein, expressed by E. coli , with tag free.

Background

Alcohol dehydrogenase proteins (ADHs) are a group of dimeric Zn-containing enzymes in the oxidoreductase family, ADHs have acetaldehyde dehydrogenase (acetylating) and alcohol dehydrogenase (NAD+) activity, enabling ADHs to oxidize the [CH-OH] group of primary or secondary alcohols using NAD+ or NADP+ as the electron acceptor. ADHs are located in cytosol and part of protein-containing complex. ADHs are expressed mainly in liver, and also exist in other structures, including circulatory system, digestive system, extended germ band embryo, fat body; and reproductive system. ADHs are up-regulated by retinoic acid, growth hormone and glucocorticoids while being down-regulated by androgens and thyroid hormone[1][2][3].

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ADH (S2-I256)
      Accession # P00334
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    AVP; AVP-NPII; Prev. ARVP; Arginine Vasopressin (Neurophysin II, Antidiuretic Hormone, Diabetes Insipidus, Neurohypophyseal); ADH; Vasopressin-Neurophysin II-Copeptin; Prepro-Arginine-Vasopressin-Neurophysin II; Arginine Vasopressin-Neurophysin II; Vasopr

  • AA Sequence

    SFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLVHKFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLGTLEAIQWTKHWDSGI

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 8.0, 500 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00