ADH Protein, Drosophila melanogaster
Based on 1 Customer Validation
ADH Protein, Drosophila melanogaster (S2-I256) is a dimeric Zn-containing enzyme in the oxidoreductase family with acetaldehyde dehydrogenase and alcohol dehydrogenase activity, therefore, can oxidize primary and secondary alcohols. ADH Protein, Drosophila melanogaster (S2-I256) is E.coli-sourced and tag-free, the initiator methionine is naturally removed. ADH Protein, Drosophila melanogaster is the recombinant ADH protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ADH Protein, Drosophila melanogaster (S2-I256) is a dimeric Zn-containing enzyme in the oxidoreductase family with acetaldehyde dehydrogenase and alcohol dehydrogenase activity, therefore, can oxidize primary and secondary alcohols. ADH Protein, Drosophila melanogaster (S2-I256) is E.coli-sourced and tag-free, the initiator methionine is naturally removed. ADH Protein, Drosophila melanogaster is the recombinant ADH protein, expressed by E. coli , with tag free.
Background
Alcohol dehydrogenase proteins (ADHs) are a group of dimeric Zn-containing enzymes in the oxidoreductase family, ADHs have acetaldehyde dehydrogenase (acetylating) and alcohol dehydrogenase (NAD+) activity, enabling ADHs to oxidize the [CH-OH] group of primary or secondary alcohols using NAD+ or NADP+ as the electron acceptor. ADHs are located in cytosol and part of protein-containing complex. ADHs are expressed mainly in liver, and also exist in other structures, including circulatory system, digestive system, extended germ band embryo, fat body; and reproductive system. ADHs are up-regulated by retinoic acid, growth hormone and glucocorticoids while being down-regulated by androgens and thyroid hormone[1][2][3].
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
P00334 (S2-I256)
-
Gene ID3771877
-
Molecular Construction
-
N-term
-
ADH (S2-I256)
Accession # P00334 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
AVP; AVP-NPII; Prev. ARVP; Arginine Vasopressin (Neurophysin II, Antidiuretic Hormone, Diabetes Insipidus, Neurohypophyseal); ADH; Vasopressin-Neurophysin II-Copeptin; Prepro-Arginine-Vasopressin-Neurophysin II; Arginine Vasopressin-Neurophysin II; Vasopr
-
AA Sequence
SFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLVHKFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLGTLEAIQWTKHWDSGI
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 8.0, 500 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
