ADIPOR1 Protein, Human (Cell-Free)
Based on 1 Customer Validation
ADIPOR1 Protein, a receptor for adiponectin (ADIPOQ), crucially regulates glucose and lipid metabolism, maintaining homeostasis and healthy body weight. Upon ADIPOQ binding, ADIPOR1 activates AMPK, promoting fatty acid oxidation and glucose uptake while inhibiting gluconeogenesis. ADIPOR1 interacts with APPL2, negatively regulating signaling, and with APPL1, enhancing ADIPOQ-induced recruitment and positive regulation of adiponectin signaling. ADIPOR1 Protein, Human (Cell-Free) is the recombinant human-derived ADIPOR1 protein, expressed by E. coli Cell-free , with tag free.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
ADIPOR1 Protein, a receptor for adiponectin (ADIPOQ), crucially regulates glucose and lipid metabolism, maintaining homeostasis and healthy body weight. Upon ADIPOQ binding, ADIPOR1 activates AMPK, promoting fatty acid oxidation and glucose uptake while inhibiting gluconeogenesis. ADIPOR1 interacts with APPL2, negatively regulating signaling, and with APPL1, enhancing ADIPOQ-induced recruitment and positive regulation of adiponectin signaling. ADIPOR1 Protein, Human (Cell-Free) is the recombinant human-derived ADIPOR1 protein, expressed by E. coli Cell-free , with tag free.
The ADIPOR1 Protein acts as a receptor for adiponectin (ADIPOQ), a vital hormone secreted by adipocytes that plays a crucial role in regulating glucose and lipid metabolism. Its functions are integral to maintaining normal glucose and fat homeostasis, as well as a healthy body weight. Upon binding to ADIPOQ, ADIPOR1 activates a signaling cascade that leads to increased AMP-activated protein kinase (AMPK) activity, resulting in enhanced fatty acid oxidation, elevated glucose uptake, and decreased gluconeogenesis. ADIPOR1 exhibits high affinity for globular adiponectin and lower affinity for full-length adiponectin. It may form homooligomers and heterooligomers with ADIPOR2. The interaction with APPL2 negatively regulates adiponectin signaling, while the interaction with APPL1 is enhanced by ADIPOQ, facilitating the recruitment of APPL1 to ADIPOR1 and positively regulating adiponectin signaling.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag Tag Free
-
Accession
Q96A54 (E89-L375)
-
Gene ID51094
-
Molecular Construction
-
N-term
-
ADIPOR1 (E89-L375)
Accession # Q96A54 -
C-term
-
-
Protein Length
Partial
-
Synonyms
ADIPOR1; Progestin And AdipoQ Receptor Family Member I; Adiponectin Receptor 1; Adiponectin Receptor Protein 1; PAQR1; TESBP1A; ACDCR1; CGI-45; Progestin And AdipoQ Receptor Family Member 1; CGI45
-
AA Sequence
EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
-
Predicted Molecular Mass
33 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% Brij-78, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
