Ag85A Protein, Mycobacterium bovis (His)
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-6*His
-
Accession
A1KQD8 (A43-A338)
-
Gene ID45427805
-
Molecular Construction
-
N-term
-
6*His
-
fbpA (A43-A338)
Accession # A1KQD8 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Diacylglycerol acyltransferase/mycolyltransferase Ag85A; EC:2.3.1.122; DGAT; EC:2.3.1.20; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex A; ; Ag85A; Fibronectin-binding protein A; Fbps A; ; mpt44; BCG_3866c
-
AA Sequence
AFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA
-
Predicted Molecular Mass
35.8 kDa
-
Purity
≥ 90%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
