1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. AK2 Protein, Human (GST)

AK2 protein plays a key role in cellular energy homeostasis and adenine nucleotide metabolism by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP. Its adenylate kinase activity plays a key role in regulating phosphate utilization and de novo AMP biosynthetic pathways, contributing to the complex balance of cellular energy resources. AK2 Protein, Human (GST) is the recombinant human-derived AK2, expressed by E. coli, with N-GST labeled tag. The total length of AK2 Protein, Human (GST) is 239 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AK2 protein plays a key role in cellular energy homeostasis and adenine nucleotide metabolism by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP. Its adenylate kinase activity plays a key role in regulating phosphate utilization and de novo AMP biosynthetic pathways, contributing to the complex balance of cellular energy resources. AK2 Protein, Human (GST) is the recombinant human-derived AK2, expressed by E. coli, with N-GST labeled tag. The total length of AK2 Protein, Human (GST) is 239 a.a..

Background

Adenylate Kinase 2 (AK2) is an enzyme that catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP, a pivotal reaction in cellular energy homeostasis and adenine nucleotide metabolism. The adenylate kinase activity of AK2 is crucial for regulating phosphate utilization and the de novo biosynthesis of AMP, key processes in cellular energy management. Beyond its role in energy metabolism, AK2 also plays a significant role in hematopoiesis, emphasizing its importance in blood cell development. The multifaceted functions of AK2 underscore its critical role in maintaining cellular energy balance, nucleotide synthesis, and supporting fundamental biological processes such as hematopoiesis.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P54819-1 (M1-I239)

Gene ID

204

Protein Length

Full Length of Isoform-1

Synonyms
Adenylate kinase 2; AK 2; ATP-AMP transphosphorylase 2; ADK2
AA Sequence

MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI

Predicted Molecular Mass
53.5 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

AK2 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AK2 Protein, Human (GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AK2 Protein, Human (GST)
Cat. No.:
HY-P702608
Quantity:
MCE Japan Authorized Agent: