AK2 Protein, Human (GST)
AK2 protein plays a key role in cellular energy homeostasis and adenine nucleotide metabolism by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP. Its adenylate kinase activity plays a key role in regulating phosphate utilization and de novo AMP biosynthetic pathways, contributing to the complex balance of cellular energy resources. AK2 Protein, Human (GST) is the recombinant human-derived AK2, expressed by E. coli, with N-GST labeled tag. The total length of AK2 Protein, Human (GST) is 239 a.a..
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
AK2 protein plays a key role in cellular energy homeostasis and adenine nucleotide metabolism by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP. Its adenylate kinase activity plays a key role in regulating phosphate utilization and de novo AMP biosynthetic pathways, contributing to the complex balance of cellular energy resources. AK2 Protein, Human (GST) is the recombinant human-derived AK2, expressed by E. coli, with N-GST labeled tag. The total length of AK2 Protein, Human (GST) is 239 a.a..
Adenylate Kinase 2 (AK2) is an enzyme that catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP, a pivotal reaction in cellular energy homeostasis and adenine nucleotide metabolism. The adenylate kinase activity of AK2 is crucial for regulating phosphate utilization and the de novo biosynthesis of AMP, key processes in cellular energy management. Beyond its role in energy metabolism, AK2 also plays a significant role in hematopoiesis, emphasizing its importance in blood cell development. The multifaceted functions of AK2 underscore its critical role in maintaining cellular energy balance, nucleotide synthesis, and supporting fundamental biological processes such as hematopoiesis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P54819-1 (M1-I239)
-
Gene ID204
-
Protein Length
Full Length of Isoform-1
-
Synonyms
AK2; ADK2; Adenylate Kinase 2; AK 2; Adenylate Kinase 2, Mitochondrial; Testis Secretory Sperm-Binding Protein Li 220n; Adenylate Monophosphate Kinase; Adenylate Kinase Isoenzyme 2, Mitochondrial; ATP-AMP Transphosphorylase 2; Adenylate Kinase 3; ATP:AMP
-
AA Sequence
MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
-
Predicted Molecular Mass
53.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
