1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. AK3L1 Protein, Human (sf9, His-GST)

The AK3L1 protein actively maintains cellular nucleotide homeostasis by catalyzing the interconversion of nucleoside phosphates. This multifunctional enzyme efficiently phosphorylates AMP and dAMP using ATP as a phosphate donor, and selectively phosphorylates AMP when utilizing GTP. AK3L1 Protein, Human (sf9, His-GST) is the recombinant human-derived AK3L1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The AK3L1 protein actively maintains cellular nucleotide homeostasis by catalyzing the interconversion of nucleoside phosphates. This multifunctional enzyme efficiently phosphorylates AMP and dAMP using ATP as a phosphate donor, and selectively phosphorylates AMP when utilizing GTP. AK3L1 Protein, Human (sf9, His-GST) is the recombinant human-derived AK3L1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

The AK3L1 protein is actively involved in maintaining cellular nucleotide homeostasis by catalyzing the interconversion of nucleoside phosphates. This versatile enzyme efficiently phosphorylates AMP and dAMP using ATP as a phosphate donor, and selectively phosphorylates AMP when utilizing GTP as the phosphate donor. Additionally, AK3L1 displays broad nucleoside diphosphate kinase activity, further contributing to its role in nucleotide metabolism. Beyond its nucleotide-related functions, AK3L1 plays a crucial role in controlling cellular ATP levels by regulating the phosphorylation and activation of the energy sensor protein kinase AMPK. Moreover, it serves a protective function in the cellular response to oxidative stress, highlighting its significance in cellular responses to various physiological conditions.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

P27144 (A2-Y223)

Gene ID

205  [NCBI]

Molecular Construction
N-term
His-GST
AK3L1 (A2-Y223)
Accession # P27144
C-term
Protein Length

Partial

Synonyms
Adenylate kinase 4; Adenylate kinase 3-like; GTP:AMP phosphotransferase AK4; AK3
AA Sequence

ASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY

Predicted Molecular Mass
53 kDa
Molecular Weight

Approximately 46 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

AK3L1 Protein, Human (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AK3L1 Protein, Human (sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AK3L1 Protein, Human (sf9, His-GST)
Cat. No.:
HY-P76717
Quantity:
MCE Japan Authorized Agent: