AK3L1 Protein, Human (sf9, His-GST)

The AK3L1 protein actively maintains cellular nucleotide homeostasis by catalyzing the interconversion of nucleoside phosphates. This multifunctional enzyme efficiently phosphorylates AMP and dAMP using ATP as a phosphate donor, and selectively phosphorylates AMP when utilizing GTP. AK3L1 Protein, Human (sf9, His-GST) is the recombinant human-derived AK3L1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

The AK3L1 protein is actively involved in maintaining cellular nucleotide homeostasis by catalyzing the interconversion of nucleoside phosphates. This versatile enzyme efficiently phosphorylates AMP and dAMP using ATP as a phosphate donor, and selectively phosphorylates AMP when utilizing GTP as the phosphate donor. Additionally, AK3L1 displays broad nucleoside diphosphate kinase activity, further contributing to its role in nucleotide metabolism. Beyond its nucleotide-related functions, AK3L1 plays a crucial role in controlling cellular ATP levels by regulating the phosphorylation and activation of the energy sensor protein kinase AMPK. Moreover, it serves a protective function in the cellular response to oxidative stress, highlighting its significance in cellular responses to various physiological conditions.

Human

Sf9 insect cells

N-His;N-GST

P27144 (A2-Y223)

205  [NCBI]

Partial

ASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY

Approximately 46 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.