AK3L1 Protein, Human (sf9)
The AK3L1 protein actively maintains cellular nucleotide homeostasis by catalyzing the interconversion of nucleoside phosphates. This multifunctional enzyme efficiently phosphorylates AMP and dAMP using ATP as a phosphate donor, and selectively phosphorylates AMP when utilizing GTP. AK3L1 Protein, Human (sf9) is the recombinant human-derived AK3L1 protein, expressed by Sf9 insect cells , with tag free.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The AK3L1 protein actively maintains cellular nucleotide homeostasis by catalyzing the interconversion of nucleoside phosphates. This multifunctional enzyme efficiently phosphorylates AMP and dAMP using ATP as a phosphate donor, and selectively phosphorylates AMP when utilizing GTP. AK3L1 Protein, Human (sf9) is the recombinant human-derived AK3L1 protein, expressed by Sf9 insect cells , with tag free.
Background
The AK3L1 protein is actively involved in maintaining cellular nucleotide homeostasis by catalyzing the interconversion of nucleoside phosphates. This versatile enzyme efficiently phosphorylates AMP and dAMP using ATP as a phosphate donor, and selectively phosphorylates AMP when utilizing GTP as the phosphate donor. Additionally, AK3L1 displays broad nucleoside diphosphate kinase activity, further contributing to its role in nucleotide metabolism. Beyond its nucleotide-related functions, AK3L1 plays a crucial role in controlling cellular ATP levels by regulating the phosphorylation and activation of the energy sensor protein kinase AMPK. Moreover, it serves a protective function in the cellular response to oxidative stress, highlighting its significance in cellular responses to various physiological conditions.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
P27144 (A2-Y223)
-
Gene ID205 [NCBI]
-
Molecular Construction
-
N-term
-
AK3L1 (A2-Y223)
Accession # P27144 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
AK4; GTP:AMP Phosphotransferase AK4, Mitochondrial; Prev. AK3L1; Epididymis Secretory Sperm Binding Protein; Prev. AK3; Nucleoside-Triphosphate-Adenylate Kinase; Adenylate Kinase 4, Mitochondrial; Mitochondrial Adenylate Kinase-3; GTP:AMP Phosphotransfera
-
AA Sequence
ASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
-
Predicted Molecular Mass
25.3 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)