1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. aKMT Protein, Sulfolobus islandicus (His, StrepⅡ)

aKMT Protein, Sulfolobus islandicus (His, StrepⅡ)

Cat. No.: HY-P701941
Handling Instructions Technical Support

Lysine methyltransferase (aKMT) is responsible for catalyzing the methylation of lysine residues in target proteins, using S-adenosyl-L-methionine (SAM) as a methyl donor. The enzyme exhibits broad substrate specificity, showing methylation primarily at "Lys-11", "Lys-16" and "Lys-31" of the vault chromatin protein Cren7 as well as several recombinant Sulfolobus proteins in vitro Ability. aKMT Protein, Sulfolobus islandicus (His, Strep) is the recombinant aKMT protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Lysine methyltransferase (aKMT) is responsible for catalyzing the methylation of lysine residues in target proteins, using S-adenosyl-L-methionine (SAM) as a methyl donor. The enzyme exhibits broad substrate specificity, showing methylation primarily at "Lys-11", "Lys-16" and "Lys-31" of the vault chromatin protein Cren7 as well as several recombinant Sulfolobus proteins in vitro Ability. aKMT Protein, Sulfolobus islandicus (His, Strep) is the recombinant aKMT protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

Background

The aKMT protein functions as a lysine methyltransferase, catalyzing the methylation of lysine residues in target proteins. This enzymatic activity is accomplished using S-adenosyl-L-methionine (SAM) as the methyl donor. aKMT displays broad substrate specificity and has the capability to methylate various target proteins. In particular, it has been observed to methylate the crenarchaeal chromatin protein Cren7 at specific lysine residues, including 'Lys-11,' 'Lys-16,' and 'Lys-31.' Additionally, aKMT exhibits sequence-independent lysine methylation, showcasing its versatility in modifying a range of target proteins in vitro.

Species

Others

Source

E. coli

Tag

N-StrepⅡ;N-6*His

Accession

F0NBH8 (S2-K161)

Gene ID

8761611

Molecular Construction
N-term
StrepⅡ-6*His
aKMT (S2-K161)
Accession # F0NBH8
C-term
Protein Length

Full Length

Synonyms
Protein-lysine N-methyltransferase; Archaeal protein lysine methyltransferase; aKMT
AA Sequence

SYVPHVPYVPTPEKVVRRMLEIAKVSQDDIVYDLGCGDGRIIITAAKDFNVKKAVGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVTMFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEVIKVEDGNMNHTVYLYVIGEHK

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

aKMT Protein, Sulfolobus islandicus (His, StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

aKMT Protein, Sulfolobus islandicus (His, StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
aKMT Protein, Sulfolobus islandicus (His, StrepⅡ)
Cat. No.:
HY-P701941
Quantity:
MCE Japan Authorized Agent: