1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. ALDH1A2 Protein, Human (His)

ALDH1A2 Protein, Human (His) is a human recombinant ALDH1A2 with a N-terminal His tag produced in E. coli. ALDH1A2 Protein, Human (His) expresses the target gene encoding Met1-Ser518.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

ALDH1A2 Protein, Human (His) is a human recombinant ALDH1A2 with a N-terminal His tag produced in E. coli. ALDH1A2 Protein, Human (His) expresses the target gene encoding Met1-Ser518.

Background

The aldehyde dehydrogenase 1 (ALDH1) family comprises major enzymes that produce retinoic acid (RA) via the oxidation of all-trans retinal and 9-cis-retinal. The ALDH1A subfamily consists of three members, ALDH1A1, ALDH1A2, and ALDH1A3. ALDH1A2 is a rate-limiting enzyme involved in the cellular synthesis of retinoic acid, which has prodifferentiation properties. ALDH1A2 is a candidate tumor suppressor. Low ALDH1A2 expression was associated with an unfavorable prognosis in head and neck squamous cell carcinoma. ALDH1A2 suppresses epithelial ovarian cancer cell proliferation and migration by downregulating STAT3[1][2].

Biological Activity

Measured by the ability to catalyze the oxidation of 4-nitrobenzaldehyde (HY-W007577) that incubate at room temperature for 5min. The specific activity is 210.34 pmol/min/μg.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O94788-1 (M1-S518)

Gene ID
Molecular Construction
N-term
6*His
ALDH1A2 (M1-S518)
Accession # O94788-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
rHuAldehyde Dehydrogenase 1-A2, His ; ALDH-1A2; Aldehyde Dehydrogenase 1-A2
AA Sequence

MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS

Molecular Weight

Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.22 μm filter solution of 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

ALDH1A2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ALDH1A2 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ALDH1A2 Protein, Human (His)
Cat. No.:
HY-P7475
Quantity:
MCE Japan Authorized Agent: