ALDH1A2 Protein, Human (His)
Based on 1 Customer Validation
ALDH1A2 Protein, Human (His) is a human recombinant ALDH1A2 with a N-terminal His tag produced in E. coli. ALDH1A2 Protein, Human (His) expresses the target gene encoding Met1-Ser518.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
ALDH1A2 Protein, Human (His) is a human recombinant ALDH1A2 with a N-terminal His tag produced in E. coli. ALDH1A2 Protein, Human (His) expresses the target gene encoding Met1-Ser518.
Background
The aldehyde dehydrogenase 1 (ALDH1) family comprises major enzymes that produce retinoic acid (RA) via the oxidation of all-trans retinal and 9-cis-retinal. The ALDH1A subfamily consists of three members, ALDH1A1, ALDH1A2, and ALDH1A3. ALDH1A2 is a rate-limiting enzyme involved in the cellular synthesis of retinoic acid, which has prodifferentiation properties. ALDH1A2 is a candidate tumor suppressor. Low ALDH1A2 expression was associated with an unfavorable prognosis in head and neck squamous cell carcinoma. ALDH1A2 suppresses epithelial ovarian cancer cell proliferation and migration by downregulating STAT3[1][2].
Verified Bioactivity
Measured by the ability to catalyze the oxidation of 4-nitrobenzaldehyde (HY-W007577) that incubate at room temperature for 5min. The specific activity is 210.34 pmol/min/μg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O94788-1 (M1-S518)
-
Molecular Construction
-
N-term
-
6*His
-
ALDH1A2 (M1-S518)
Accession # O94788-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
ALDH1A2; RALDH 2; Aldehyde Dehydrogenase 1 Family Member A2; Aldehyde Dehydrogenase 1 Family, Member A2; RALDH2; Aldehyde Dehydrogenase Family 1 Member A2; Retinaldehyde-Specific Dehydrogenase Type 2; Retinaldehyde Dehydrogenase 2; Retinal Dehydrogenase 2
-
AA Sequence
MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
-
Molecular Weight
Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filter solution of 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (265 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Choi JA, et al. ALDH1A2 Is a Candidate Tumor Suppressor Gene in Ovarian Cancer. Cancers (Basel). 2019 Oct 14;11(10). pii: E1553. [Content Brief]
[2]. Wang Y, et al. ALDH1A2 suppresses epithelial ovarian cancer cell proliferation and migration by downregulating STAT3. Onco Targets Ther. 2018 Jan 31;11:599-608. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
