1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. ALDH1A2 Protein, Human (His)

ALDH1A2 Protein, Human (His)

Cat. No.: HY-P7475
Handling Instructions

ALDH1A2 Protein, Human (His) is a human recombinant ALDH1A2 with a N-terminal His tag produced in E. coli. ALDH1A2 Protein, Human (His) expresses the target gene encoding Met1-Ser518.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $360 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

ALDH1A2 Protein, Human (His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

N-His

Accession

O94788 (M1-S518)

Gene ID

8854

Synonyms
rHuAldehyde Dehydrogenase 1-A2, His ; ALDH-1A2; Aldehyde Dehydrogenase 1-A2
AA Sequence

HHHHHHMTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS

Molecular Weight

50-65 kDa

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

The aldehyde dehydrogenase 1 (ALDH1) family comprises major enzymes that produce retinoic acid (RA) via the oxidation of all-trans retinal and 9-cis-retinal. The ALDH1A subfamily consists of three members, ALDH1A1, ALDH1A2, and ALDH1A3. ALDH1A2 is a rate-limiting enzyme involved in the cellular synthesis of retinoic acid, which has prodifferentiation properties. ALDH1A2 is a candidate tumor suppressor. Low ALDH1A2 expression was associated with an unfavorable prognosis in head and neck squamous cell carcinoma. ALDH1A2 suppresses epithelial ovarian cancer cell proliferation and migration by downregulating STAT3[1][2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ALDH1A2 Protein, Human (His)
Cat. No.:
HY-P7475
Quantity:
MCE Japan Authorized Agent: