Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His)
Based on 1 Customer Validation
Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His) is the recombinant rat-derived Alkaline Phosphatase/ALPG, expressed by HEK293, with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His) is the recombinant rat-derived Alkaline Phosphatase/ALPG, expressed by HEK293, with C-His labeled tag.
Background
The Alkaline Phosphatase/ALPG protein is an enzyme that possesses the capability to hydrolyze a range of phosphate compounds. It exhibits the ability to break down various phosphate molecules through its enzymatic activity. This protein acts as an alkaline phosphatase, catalyzing the hydrolysis of phosphate esters in an alkaline environment. Its enzymatic activity allows it to cleave phosphate groups from molecules such as nucleotides, proteins, and phospholipids, rendering them inactive. This versatile enzyme plays a vital role in various physiological processes, including bone mineralization, cellular signaling, and metabolism.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-8*His
-
Accession
F1M8U7 (V22-P510)
-
Gene ID/
-
Protein Length
Partial
-
Synonyms
ALPG; Alkaline Phosphatase Nagao Isozyme; Prev. ALPPL2; ALP-1; GCAP; Testicular And Thymus Alkaline Phosphatase; Germ Cell Alkaline Phosphatase; Placental-Like Alkaline Phosphatase; Alkaline Phosphatase, Placental Like 2; Placental Alkaline Phosphatase-Li
-
AA Sequence
VIPVEEENPAFWNQKAKEALDVAKKLKPIRTSAKNLIIFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTSVQHASPAGTYAHTVNCDWYSDAHMATAALQEGCKDIAMQLISNMDIDVILGGGRKFMFPKGTPDPEYSGNRAQSGTRLDGQNLVQKWLAKHQGARYVWNRTELIQASQDSAVTHLMGLFEPNDMKYDIYRDPTQDPSLAEMTEVAVHLLSRNPKGFYLFVEGGHIDHGHHESIAYRALTEAVMFDSAVDKANKLTSEKDTMILVTADHSHVFSFGGYVPRGTSIFGLGASFNALDGRPFTSILYGNGPGYKLEKGTRPDVTDKESRDPKYRQQAAVPLSSETHSGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAGRSSAVSP
-
Predicted Molecular Mass
54.1 kDa
-
Molecular Weight
Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
