1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Phosphatase
  4. Alkaline Phosphatase
  5. Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His)

Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His)

Cat. No.: HY-P702581
Handling Instructions Technical Support

Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His) is the recombinant rat-derived Alkaline Phosphatase/ALPG, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His) is the recombinant rat-derived Alkaline Phosphatase/ALPG, expressed by HEK293, with C-His labeled tag.

Background

The Alkaline Phosphatase/ALPG protein is an enzyme that possesses the capability to hydrolyze a range of phosphate compounds. It exhibits the ability to break down various phosphate molecules through its enzymatic activity. This protein acts as an alkaline phosphatase, catalyzing the hydrolysis of phosphate esters in an alkaline environment. Its enzymatic activity allows it to cleave phosphate groups from molecules such as nucleotides, proteins, and phospholipids, rendering them inactive. This versatile enzyme plays a vital role in various physiological processes, including bone mineralization, cellular signaling, and metabolism.

Species

Rat

Source

HEK293

Tag

C-8*His

Accession

F1M8U7 (V22-P510)

Gene ID

/

Protein Length

Partial

Synonyms
Alkaline Phosphatase; ALP-1; Alkaline phosphatase, placental-like; GCAP; PLAP-like; ALPG; ALPPL; ALPPL2
AA Sequence

VIPVEEENPAFWNQKAKEALDVAKKLKPIRTSAKNLIIFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTSVQHASPAGTYAHTVNCDWYSDAHMATAALQEGCKDIAMQLISNMDIDVILGGGRKFMFPKGTPDPEYSGNRAQSGTRLDGQNLVQKWLAKHQGARYVWNRTELIQASQDSAVTHLMGLFEPNDMKYDIYRDPTQDPSLAEMTEVAVHLLSRNPKGFYLFVEGGHIDHGHHESIAYRALTEAVMFDSAVDKANKLTSEKDTMILVTADHSHVFSFGGYVPRGTSIFGLGASFNALDGRPFTSILYGNGPGYKLEKGTRPDVTDKESRDPKYRQQAAVPLSSETHSGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAGRSSAVSP

Molecular Weight

55-70 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His)
Cat. No.:
HY-P702581
Quantity:
MCE Japan Authorized Agent: