1. Recombinant Proteins
  2. Receptor Proteins
  3. Allergin-1 Protein, Mouse (HEK293, Fc)

Allergin-1 protein, an immunoglobulin-like receptor, inhibits mast cell degranulation and suppresses hypersensitivity reactions. It interacts with tyrosine-phosphorylated proteins, such as PTPN6, PTPN11, and INPP5D, to fine-tune mast cell responses. Allergin-1 plays a pivotal role in regulating allergic reactions and hypersensitivity responses. Allergin-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Allergin-1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Allergin-1 protein, an immunoglobulin-like receptor, inhibits mast cell degranulation and suppresses hypersensitivity reactions. It interacts with tyrosine-phosphorylated proteins, such as PTPN6, PTPN11, and INPP5D, to fine-tune mast cell responses. Allergin-1 plays a pivotal role in regulating allergic reactions and hypersensitivity responses. Allergin-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Allergin-1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Allergin-1 protein, an immunoglobulin-like receptor, assumes an inhibitory role in the degranulation process of mast cells. Functioning as a negative regulator, it plays a crucial part in mitigating IgE-mediated mast cell activation and suppressing type I immediate hypersensitivity reactions. Allergin-1 exists as a monomer, and it interacts specifically with tyrosine-phosphorylated proteins such as PTPN6, PTPN11, and INPP5D. This intricate molecular interaction underscores the pivotal role of Allergin-1 in fine-tuning mast cell responses, contributing to the intricate regulatory mechanisms that modulate allergic reactions and hypersensitivity responses.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q3TB92-1 (I34-S150)

Gene ID
Molecular Construction
N-term
Allergin-1 (I34-S150)
Accession # Q3TB92-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Allergy inhibitory receptor 1; Mast cell antigen 32; MCA-32; Milr1; Gm885
AA Sequence

ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS

Molecular Weight

55-80 kDa.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS,pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Allergin-1 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Allergin-1 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Allergin-1 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P76719
Quantity:
MCE Japan Authorized Agent: