Copy Link Print Information

Allergin-1 Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

Allergin-1 protein, an immunoglobulin-like receptor, inhibits mast cell degranulation and suppresses hypersensitivity reactions. It interacts with tyrosine-phosphorylated proteins, such as PTPN6, PTPN11, and INPP5D, to fine-tune mast cell responses. Allergin-1 plays a pivotal role in regulating allergic reactions and hypersensitivity responses. Allergin-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Allergin-1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Allergin-1 Protein, Mouse (HEK293, Fc)
  • Allergin-1 Protein, Mouse (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Allergin-1 protein, an immunoglobulin-like receptor, inhibits mast cell degranulation and suppresses hypersensitivity reactions. It interacts with tyrosine-phosphorylated proteins, such as PTPN6, PTPN11, and INPP5D, to fine-tune mast cell responses. Allergin-1 plays a pivotal role in regulating allergic reactions and hypersensitivity responses. Allergin-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Allergin-1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Allergin-1 protein, an immunoglobulin-like receptor, assumes an inhibitory role in the degranulation process of mast cells. Functioning as a negative regulator, it plays a crucial part in mitigating IgE-mediated mast cell activation and suppressing type I immediate hypersensitivity reactions. Allergin-1 exists as a monomer, and it interacts specifically with tyrosine-phosphorylated proteins such as PTPN6, PTPN11, and INPP5D. This intricate molecular interaction underscores the pivotal role of Allergin-1 in fine-tuning mast cell responses, contributing to the intricate regulatory mechanisms that modulate allergic reactions and hypersensitivity responses.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession

    Q3TB92-1 (I34-S150)

  • Gene ID
    380732  [NCBI]
  • Molecular Construction
    • N-term
    • Allergin-1 (I34-S150)
      Accession # Q3TB92-1
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    MILR1; MCA-32; Prev. C17orf60; MCA32; Allergin-1; Probable Mast Cell Antigen 32 Homolog; Allergy Inhibitory Receptor 1; Chromosome 17 Open Reading Frame 60; Mast Cell Antigen 32; Mast Cell Immunoglobulin Like Receptor 1; Mast Cell Immunoglobulin-Like Rece

  • AA Sequence

    ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS

  • Predicted Molecular Mass

    39.8 kDa

  • Molecular Weight

    Approximately 55-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS,pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Allergin-1 Protein, Mouse (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for Allergin-1 Protein, Mouse (HEK293, Fc)
  • Allergin-1 Protein, Mouse (HEK293, Fc) Product Image