1. Recombinant Proteins
  2. Receptor Proteins
  3. Allergin-1 Protein, Mouse (HEK293, Fc)

Allergin-1 protein, an immunoglobulin-like receptor, inhibits mast cell degranulation and suppresses hypersensitivity reactions. It interacts with tyrosine-phosphorylated proteins, such as PTPN6, PTPN11, and INPP5D, to fine-tune mast cell responses. Allergin-1 plays a pivotal role in regulating allergic reactions and hypersensitivity responses. Allergin-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Allergin-1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Allergin-1 protein, an immunoglobulin-like receptor, inhibits mast cell degranulation and suppresses hypersensitivity reactions. It interacts with tyrosine-phosphorylated proteins, such as PTPN6, PTPN11, and INPP5D, to fine-tune mast cell responses. Allergin-1 plays a pivotal role in regulating allergic reactions and hypersensitivity responses. Allergin-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Allergin-1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Allergin-1 protein, an immunoglobulin-like receptor, assumes an inhibitory role in the degranulation process of mast cells. Functioning as a negative regulator, it plays a crucial part in mitigating IgE-mediated mast cell activation and suppressing type I immediate hypersensitivity reactions. Allergin-1 exists as a monomer, and it interacts specifically with tyrosine-phosphorylated proteins such as PTPN6, PTPN11, and INPP5D. This intricate molecular interaction underscores the pivotal role of Allergin-1 in fine-tuning mast cell responses, contributing to the intricate regulatory mechanisms that modulate allergic reactions and hypersensitivity responses.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q3TB92-1 (I34-S150)

Gene ID
Molecular Construction
N-term
Allergin-1 (I34-S150)
Accession # Q3TB92-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Allergy inhibitory receptor 1; Mast cell antigen 32; MCA-32; Milr1; Gm885
AA Sequence

ITLQNAAVDCTRVENNELPSPNLNSSMNVVRMGQNVSLSCSTKNTSVDITYSLFWGTKYLESKRRRGGAVDFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLS

Molecular Weight

55-80 kDa.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS,pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Allergin-1 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Allergin-1 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Allergin-1 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P76719
Quantity:
MCE Japan Authorized Agent: