Alpha-crystallin A chain/CRYAA Protein, Rat (His)
Alpha-crystallin A chain/CRYAA Protein, Rat (His) is a recombinant Alpha-crystallin A chain protein with a His tag. Alpha-crystallin A chain/CRYAA is a small heat shock protein and molecular chaperone that prevents nonspecific aggregation of denaturing proteins.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
Alpha-crystallin A chain/CRYAA Protein, Rat (His) is a recombinant Alpha-crystallin A chain protein with a His tag. Alpha-crystallin A chain/CRYAA is a small heat shock protein and molecular chaperone that prevents nonspecific aggregation of denaturing proteins.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag C-6*His
-
Accession
P24623 (M1-S196)
-
Gene ID24273
-
Molecular Construction
-
N-term
-
CRYAA (M1-S196)
Accession # P24623 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CRYAA; Human AlphaA-Crystallin (CRYA1); Prev. CRYA1; Crystallin, Alpha A; HSPB4; Crystallin, Alpha-1; Alpha-Crystallin A Chain; CTRCT9; Heat Shock Protein Family B Member 4; HspB4; Heat Shock Protein Beta-4; Crystallin Alpha A; Alpha Crystallin A Chain
-
AA Sequence
MDVTIQHPWFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISELMTHMWFVMHQPHAGNPKNNPGKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAIPVSREEKPSSAPSS
-
Predicted Molecular Mass
29.4 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
