AMHR2/MISRII Protein, Human (HEK293, mFc)
AMHR2/MISRII Protein, upon ligand binding, forms a receptor complex with two type II and two type I kinases. Type II receptors activate type I receptors through phosphorylation, leading to autophosphorylation. Activated type I receptors engage SMAD transcriptional regulators, initiating downstream signaling pathways. Crucially, AMHR2/MISRII acts as a receptor for anti-Muellerian hormone, mediating cellular responses triggered by the hormone. AMHR2/MISRII, Human (HEK293, mFc) is the recombinant human-derived AMHR2/MISRII protein, expressed by HEK293, with N-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
AMHR2/MISRII Protein, upon ligand binding, forms a receptor complex with two type II and two type I kinases. Type II receptors activate type I receptors through phosphorylation, leading to autophosphorylation. Activated type I receptors engage SMAD transcriptional regulators, initiating downstream signaling pathways. Crucially, AMHR2/MISRII acts as a receptor for anti-Muellerian hormone, mediating cellular responses triggered by the hormone. AMHR2/MISRII, Human (HEK293, mFc) is the recombinant human-derived AMHR2/MISRII protein, expressed by HEK293, with N-6*His labeled tag.
Background
Upon ligand binding, AMHR2/MISRII Protein assembles into a receptor complex composed of two type II and two type I transmembrane serine/threonine kinases. The type II receptors phosphorylate and activate the type I receptors, initiating their autophosphorylation. Subsequently, these activated type I receptors engage with SMAD transcriptional regulators, leading to the activation of downstream signaling pathways. Notably, AMHR2/MISRII serves as a receptor for anti-Muellerian hormone, playing a crucial role in mediating the cellular responses triggered by this hormone.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
Q16671-1 (P18-S144)
-
Gene ID269
-
Molecular Construction
-
N-term
-
AMHR2 (P18-S144)
Accession # Q16671-1 -
mFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
AMHR2; MIS Type II Receptor; Anti-Mullerian Hormone Receptor Type 2; AMHR; MISRII; MRII; MISR2; Mullerian Inhibiting Substance Type II Receptor; Muellerian Inhibiting Substance Type II Receptor; Anti-Mullerian Hormone Receptor, Type II; Anti-Muellerian Ho
-
AA Sequence
PPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES
-
Predicted Molecular Mass
40.4 kDa
-
Molecular Weight
Approximately 48-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<0.1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
