1. Recombinant Proteins
  2. Enzymes & Regulators
  3. AMPKG1 Protein, Human (sf9, GST)

AMPK gamma 1 is the AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK) and is an important regulator of cellular energy metabolism. It is activated by low ATP levels, enhancing energy production while inhibiting biosynthetic processes and cell growth. AMPKG1 Protein, Human (sf9, GST) is the recombinant human-derived AMPKG1, expressed by Sf9 insect cells, with GST labeled tag. The total length of AMPKG1 Protein, Human (sf9, GST) is 331 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
20 μg Get quote
100 μg Get quote

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AMPK gamma 1 is the AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK) and is an important regulator of cellular energy metabolism. It is activated by low ATP levels, enhancing energy production while inhibiting biosynthetic processes and cell growth. AMPKG1 Protein, Human (sf9, GST) is the recombinant human-derived AMPKG1, expressed by Sf9 insect cells, with GST labeled tag. The total length of AMPKG1 Protein, Human (sf9, GST) is 331 a.a..

Background

The AMPK gamma 1/beta 1/alpha 1 heterotrimer serves as the AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), a pivotal regulator of cellular energy metabolism. When intracellular ATP levels decrease, AMPK is activated, initiating a cascade of events that enhance energy production while suppressing energy-consuming processes such as protein, carbohydrate, and lipid biosynthesis, as well as cell growth and proliferation. The gamma non-catalytic subunit of AMPK mediates binding to AMP, ADP, and ATP, influencing the activation or inhibition of AMPK. AMP binding allosterically activates the alpha catalytic subunit by inducing phosphorylation and preventing dephosphorylation. ADP stimulates phosphorylation, while ATP promotes dephosphorylation, rendering the AMPK enzyme inactive. Beyond its role in energy regulation, AMPK acts as a modulator of cellular polarity by remodeling the actin cytoskeleton, potentially through the indirect activation of myosin. The heterotrimeric composition of AMPK includes an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta subunit (PRKAB1 or PRKAB2), and a gamma non-catalytic subunit (PRKAG1, PRKAG2, or PRKAG3), highlighting its intricate regulatory mechanisms. AMPK further interacts with FNIP1 and FNIP2 to modulate its cellular functions.

Species

Human

Source

Sf9 insect cells

Tag

GST

Accession

P54619-1 (M1-P331)

Gene ID

5571

Protein Length

Full Length of Isoform-1

Synonyms
5'-AMP-activated protein kinase subunit gamma-1; AMPK gamma1; AMPK subunit gamma-1; AMPKg; PRKAG1
AA Sequence

METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP

Predicted Molecular Mass
68 kDa
Purity

≥ 80%, as determined by reducing SDS-PAGE.

Documentation

AMPKG1 Protein, Human (sf9, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AMPKG1 Protein, Human (sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AMPKG1 Protein, Human (sf9, GST)
Cat. No.:
HY-P702979
Quantity:
MCE Japan Authorized Agent: