AMPKG1 Protein, Human (sf9, GST)

AMPK gamma 1 is the AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK) and is an important regulator of cellular energy metabolism. It is activated by low ATP levels, enhancing energy production while inhibiting biosynthetic processes and cell growth. AMPKG1 Protein, Human (sf9, GST) is the recombinant human-derived AMPKG1, expressed by Sf9 insect cells, with GST labeled tag. The total length of AMPKG1 Protein, Human (sf9, GST) is 331 a.a..

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

AMPK gamma 1 is the AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK) and is an important regulator of cellular energy metabolism. It is activated by low ATP levels, enhancing energy production while inhibiting biosynthetic processes and cell growth. AMPKG1 Protein, Human (sf9, GST) is the recombinant human-derived AMPKG1, expressed by Sf9 insect cells, with GST labeled tag. The total length of AMPKG1 Protein, Human (sf9, GST) is 331 a.a..

Background

The AMPK gamma 1/beta 1/alpha 1 heterotrimer serves as the AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), a pivotal regulator of cellular energy metabolism. When intracellular ATP levels decrease, AMPK is activated, initiating a cascade of events that enhance energy production while suppressing energy-consuming processes such as protein, carbohydrate, and lipid biosynthesis, as well as cell growth and proliferation. The gamma non-catalytic subunit of AMPK mediates binding to AMP, ADP, and ATP, influencing the activation or inhibition of AMPK. AMP binding allosterically activates the alpha catalytic subunit by inducing phosphorylation and preventing dephosphorylation. ADP stimulates phosphorylation, while ATP promotes dephosphorylation, rendering the AMPK enzyme inactive. Beyond its role in energy regulation, AMPK acts as a modulator of cellular polarity by remodeling the actin cytoskeleton, potentially through the indirect activation of myosin. The heterotrimeric composition of AMPK includes an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta subunit (PRKAB1 or PRKAB2), and a gamma non-catalytic subunit (PRKAG1, PRKAG2, or PRKAG3), highlighting its intricate regulatory mechanisms. AMPK further interacts with FNIP1 and FNIP2 to modulate its cellular functions.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag GST
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PRKAG1; 5'-AMP-Activated Protein Kinase, Gamma-1 Subunit; Protein Kinase AMP-Activated Non-Catalytic Subunit Gamma 1; AMPK Subunit Gamma-1; 5'-AMP-Activated Protein Kinase Subunit Gamma-1; AMPK Gamma-1 Chain; Protein Kinase, AMP-Activated, Gamma 1 Non-Cat

  • AA Sequence

    METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP

  • Molecular Weight

    Approximately 68 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00