AMSH Protein, Human
AMSH is a zinc metalloprotease that selectively cleaves "Lys-63"-linked polyubiquitin chains, but not "Lys-48"-linked chains. It plays a critical regulatory role in signaling in IL-2 and GM-CSF mediated pathways, acting as a positive BMP signaling modulator against SMAD6 and SMAD7 inhibition. AMSH Protein, Human is the recombinant human-derived AMSH protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Almacenamiento:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Technical Parameters
-
Product Properties
- Documentación
- Help & FAQs
Actividad biológica
Descripciòn
AMSH is a zinc metalloprotease that selectively cleaves "Lys-63"-linked polyubiquitin chains, but not "Lys-48"-linked chains. It plays a critical regulatory role in signaling in IL-2 and GM-CSF mediated pathways, acting as a positive BMP signaling modulator against SMAD6 and SMAD7 inhibition. AMSH Protein, Human is the recombinant human-derived AMSH protein, expressed by E. coli , with tag free.
Background
AMSH is a zinc metalloprotease with a specific affinity for cleaving 'Lys-63'-linked polyubiquitin chains, excluding 'Lys-48'-linked polyubiquitin chains. It plays a crucial role in signal transduction associated with cell growth, particularly in the context of IL-2 and GM-CSF-mediated pathways. Additionally, AMSH acts as a positive regulator of BMP signaling by counteracting the inhibitory effects of SMAD6 and SMAD7. The protein is instrumental in orchestrating cell surface receptor-mediated endocytosis, facilitating ubiquitin-dependent sorting of receptors to lysosomes. While the endosomal localization of AMSH is vital for efficient EGFR degradation, it is dispensable for receptor internalization. Moreover, AMSH is intricately involved in the negative regulation of PI3K-AKT-mTOR and RAS-MAP signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O95630 (S2-R424)
-
Gene ID10617
-
Molecular Construction
-
N-term
-
AMSH (S2-R424)
Accession # O95630 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
STAMBP; Endosome-Associated Ubiquitin Isopeptidase; STAM Binding Protein; Testicular Secretory Protein Li 54; AMSH; Alternative Protein STAMBP; Associated Molecule With The SH3 Domain Of STAM; MICCAP; STAM-Binding Protein
-
AA Sequence
SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR
-
Pureza
≥85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentación
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
