Angiopoietin-2 Protein, Mouse (CHO, His)
Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (CHO, His) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by CHO, with C-His labeled tag.
- Species: Mouse
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (CHO, His) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by CHO, with C-His labeled tag.
Background
Angiopoietin-2 Protein (ANGPT2) binds to TEK/TIE2 and competes with ANGPT1 for the binding site, thereby modulating ANGPT1 signaling. It has the ability to induce tyrosine phosphorylation of TEK/TIE2 even in the absence of ANGPT1. In the absence of angiogenic inducers like VEGF, ANGPT2 can cause loosening of cell-matrix contacts, potentially leading to endothelial cell apoptosis and subsequent vascular regression. However, when working in conjunction with VEGF, it can promote endothelial cell migration and proliferation, making it a permissive angiogenic signal. ANGPT2 also plays a role in the regulation of lymphangiogenesis. Additionally, it interacts with TEK/TIE2, competing for the same binding site as ANGPT1, and interacts with ITGA5.
Technical Parameters
-
Species Mouse
-
Source CHO
-
Tag C-His
-
Accession
O35608 (Y19-F496)
-
Gene ID11601
-
Molecular Construction
-
N-term
-
Angiopoietin-2 (Y19-F496)
Accession # O35608 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ANGPT2; Angiopoietin-2a; Angiopoietin 2; Tie2-Ligand; Ang2; LMPHM10; Angiopoietin-2; AGPT2; Angiopoietin-2B; ANG-2
-
AA Sequence
YSNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPYMSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLMETVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
-
Predicted Molecular Mass
56.4 kDa
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
