ANGPTL8 Protein, Human (HEK293, His, Mys)
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
Q6UXH0 ( A22-A198)
-
Gene ID55908
-
Molecular Construction
-
N-term
-
10*His
-
ANGPTL8 (A22-A198)
Accession # Q6UXH0 -
Myc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ANGPTL8; Hepatocellular Carcinoma-Associated Gene TD26, Isoform CRA_a; Prev. C19orf80; Hepatocellular Carcinoma-Associated Gene TD26; RIFL; Chromosome 19 Open Reading Frame 80; Lipasin; Angiopoietin-Like 8; TD26; LOC55908; Refeeding-Induced Fat And Liver
-
AA Sequence
APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
-
Predicted Molecular Mass
24.9 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
