Animal-Free CDNF Protein, Human (His)

Customer Review

Based on 1 Customer Validation

CDNF (cerebral dopamine neurotrophic factor) functions as an important trophic factor, providing unique support to dopamine neurons. Its protective effect has a clear role in preventing 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. Animal-Free CDNF Protein, Human (His) is the recombinant human-derived animal-FreeCDNF protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CDNF (cerebral dopamine neurotrophic factor) functions as an important trophic factor, providing unique support to dopamine neurons. Its protective effect has a clear role in preventing 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. Animal-Free CDNF Protein, Human (His) is the recombinant human-derived animal-FreeCDNF protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Background

CDNF (Cerebral Dopamine Neurotrophic Factor) emerges as a vital trophic factor with a distinctive role in supporting dopamine neurons. Its protective capabilities extend to preventing the degeneration of dopaminergic neurons induced by 6-hydroxydopamine (6-OHDA). Notably, when administered subsequent to 6-OHDA-lesioning, CDNF exhibits the remarkable ability to restore dopaminergic function and effectively thwart the degeneration of neurons within the substantia nigra, underscoring its therapeutic potential in mitigating neurodegenerative processes.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CDNF (Q27-L187)
      Accession # Q49AH0-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    CDNF; Conserved Dopamine Neurotrophic Factor; Prev. ARMETL1; ARMET-Like Protein 1; Cerebral Dopamine Neurotrophic Factor; Arginine-Rich, Mutated In Early Stage Tumors-Like 1

  • AA Sequence

    QEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL

  • Predicted Molecular Mass

    19.3 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00