Animal-Free Galectin-16 Protein, Human (His)

Galectin-16 is a soluble β-galactoside binding protein that regulates key biological processes such as cell growth, differentiation, apoptosis and immune response. Galectin-16 alters expression associated with cancer, diabetes, and brain disease. Animal-Free Galectin-16 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-16 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

Galactoside is a soluble β-galactoside binding protein that regulates key biological processes such as cell growth, differentiation, apoptosis and immune response. Galectin-16 may regulate signal transduction pathways via c-Rel hubs in B cells or T cells at the maternal-fetal interface. Galectin-16 alters expression associated with cancer, diabetes, and brain disease^[1][2][3].

Human

E. coli

N-6*His

A8MUM7 (S2-R142)

148003  [NCBI]

Full Length

SFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCLNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNGRR

Approximately 16-18 kDa,based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU/μg, determined by LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.