Animal-Free Galectin-16 Protein, Human (His)
Based on 1 Customer Validation
Galectin-16 is a soluble β-galactoside binding protein that regulates key biological processes such as cell growth, differentiation, apoptosis and immune response. Galectin-16 alters expression associated with cancer, diabetes, and brain disease. Animal-Free Galectin-16 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-16 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Galectin-16 is a soluble β-galactoside binding protein that regulates key biological processes such as cell growth, differentiation, apoptosis and immune response. Galectin-16 alters expression associated with cancer, diabetes, and brain disease. Animal-Free Galectin-16 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-16 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.
Background
Galactoside is a soluble β-galactoside binding protein that regulates key biological processes such as cell growth, differentiation, apoptosis and immune response. Galectin-16 may regulate signal transduction pathways via c-Rel hubs in B cells or T cells at the maternal-fetal interface. Galectin-16 alters expression associated with cancer, diabetes, and brain disease[1][2][3].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
A8MUM7 (S2-R142)
-
Gene ID148003 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
Galectin-16 (S2-R142)
Accession # A8MUM7 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
LGALS16; Galectin-16; Galectin 16; Beta-Galactoside-Binding Lectin; Lectin, Galactoside-Binding, Soluble, 16
-
AA Sequence
SFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCLNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNGRR
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.
<0.1 EU/μg, determined by LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
