Copy Link Print Information

Animal-Free IFN-lambda 2/IL-28A Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

Animal-Free IFN-lambda 2/IL-28A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free IFN-lambda 2/IL-28A Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Animal-Free IFN-lambda 2/IL-28A Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN-lambda 2/IL-28A protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Background

IFN-lambda 2/IL-28A Protein, a versatile cytokine, exhibits antiviral, antitumoral, and immunomodulatory activities, playing a crucial role in antiviral host defense, primarily within epithelial tissues. Functioning as a ligand for the heterodimeric class II cytokine receptor, consisting of IL10RB and IFNLR1, its receptor engagement initiates the JAK/STAT signaling pathway, resulting in the expression of IFN-stimulated genes (ISG) that establish an antiviral state. With a confined receptor distribution, it predominantly operates in epithelial cells due to the epithelial cell-specific expression of its receptor IFNLR1. While not deemed essential for early virus-activated host defense in vaginal infection, it assumes a significant role in Toll-like receptor (TLR)-induced antiviral defense and plays a crucial part in the antiviral immune defense in the intestinal epithelium. Additionally, IFN-lambda 2/IL-28A exerts an immunomodulatory effect by up-regulating MHC class I antigen expression, contributing to its impact on immune responses.

Verified Bioactivity

Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <2 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-6*His
  • Accession

    AAX58714.1 (D20-V193)

  • Gene ID
    330496  [NCBI]
  • Molecular Construction
    • N-term
    • IFN-λ2 (D20-V193)
      Accession # AAX58714.1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Interferon lambda-2 Chain

  • Synonyms

    IFNL2; Interleukin-28A; Prev. IL28A; Interleukin 28A; IL-28A; ZCYTO20; Interleukin 28A (Interferon, Lambda 2); IFNL2a; Interferon Lambda-2; IFNL3a; Cytokine Zcyto20; Interferon Lambda 2; IFN-Lambda-2

  • AA Sequence

    DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV

  • Predicted Molecular Mass

    20.6 kDa

  • Molecular Weight

    Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free IFN-lambda 2/IL-28A Protein, Mouse (His) Product Image
    1/16
  • Animal-Free IFN-lambda 2/IL-28A Protein, Mouse (His) Product Image