Animal-Free IFN-lambda 3/IL-28B Protein, Mouse (His)
Based on 1 Customer Validation
The IFN-lambda 3/IL-28B protein is a cytokine with antiviral, antitumor, and immunomodulatory properties that is critical for defense against viruses, especially in epithelial tissues. It acts as a ligand for IL10RB and IFNLR1 receptor complexes, activating the JAK/STAT signaling pathway and inducing IFN-stimulated genes (ISG) into an antiviral state. Animal-Free IFN-lambda 3/IL-28B Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN-lambda 3/IL-28B protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The IFN-lambda 3/IL-28B protein is a cytokine with antiviral, antitumor, and immunomodulatory properties that is critical for defense against viruses, especially in epithelial tissues. It acts as a ligand for IL10RB and IFNLR1 receptor complexes, activating the JAK/STAT signaling pathway and inducing IFN-stimulated genes (ISG) into an antiviral state. Animal-Free IFN-lambda 3/IL-28B Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIFN-lambda 3/IL-28B protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.
Background
IFN-lambda 3/IL-28B Protein is a cytokine that exhibits antiviral, antitumour, and immunomodulatory properties. It plays a crucial role in the host defense against viruses, particularly in epithelial tissues. This protein acts as a ligand for the IL10RB and IFNLR1 receptor complex, leading to the activation of the JAK/STAT signaling pathway and the expression of IFN-stimulated genes (ISG) that contribute to the antiviral state. Its receptor is primarily expressed in epithelial cells, which explains its cell type-selective action. Although it may not be essential for early host defense in vaginal infections, it plays a significant role in Toll-like receptor (TLR)-induced antiviral defense and the immune defense in the intestinal epithelium. Furthermore, IFN-lambda 3/IL-28B Protein also exerts an immunomodulatory effect by up-regulating MHC class I antigen expression.
Verified Bioactivity
Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <20 ng/mL.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
Q8CGK6 (D20-V193)
-
Molecular Construction
-
N-term
-
IFN-λ3 (D20-V193)
Accession # Q8CGK6 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNL3; Interleukin-28C; Prev. IL28B; IL-28C; IL-28B; Interferon, Lambda 4; IL28C; Interleukin 28B; Interleukin 28B (Interferon, Lambda 3); Interferon 1IA1; Interferon Lambda-3; IFN-Lambda-4; Cytokine Zcyto22; ZCYTO22; Interleukin-28B; Interferon Lambda 3;
-
AA Sequence
DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLLRDLKCVASGDQCV
-
Predicted Molecular Mass
20.6 kDa
-
Molecular Weight
Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<0.1 EU/μg, determined by LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
