Animal-Free IL-24 Protein, Mouse (His)

IL-24 Protein, a crucial immune regulatory cytokine, plays a pivotal role in modulating immune responses. Animal-Free IL-24 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-24 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

IL-24, also known as Interleukin-24, is a crucial immune regulatory cytokine that plays a pivotal role in modulating immune responses. This protein is involved in regulating various aspects of the immune system, including inflammation and anti-tumor responses. IL-24 is known for its diverse functions, such as inducing apoptosis (programmed cell death) in cancer cells while sparing normal cells, making it a promising candidate for cancer therapy. Additionally, IL-24 has anti-inflammatory properties and contributes to the regulation of immune cell activities.

Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED₅₀ for this effect is <0.3 ng/mL.

Mouse

E. coli

C-6*His

A0A0R4J1N5 (Q27-L181)

93672

Full Length of Mature Protein

QEFRFGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIRLLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNFIVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.