Animal-Free IL-24 Protein, Mouse (His)

IL-24 Protein, a crucial immune regulatory cytokine, plays a pivotal role in modulating immune responses. Animal-Free IL-24 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-24 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-24 Protein, Mouse (His) is 155 a.a., with molecular weight of ~18.94 kDa.

IL-24, also known as Interleukin-24, is a crucial immune regulatory cytokine that plays a pivotal role in modulating immune responses. This protein is involved in regulating various aspects of the immune system, including inflammation and anti-tumor responses. IL-24 is known for its diverse functions, such as inducing apoptosis (programmed cell death) in cancer cells while sparing normal cells, making it a promising candidate for cancer therapy. Additionally, IL-24 has anti-inflammatory properties and contributes to the regulation of immune cell activities.

Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED₅₀ for this effect is <0.3 ng/mL.

Mouse

E. coli

C-His

A0A0R4J1N5 (Q27-L181)

93672

MQEFRFGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIRLLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNFIVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL

Approximately 18.94 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.