Animal-Free Midkine Protein, Mouse (His)
Based on 1 publication(s) in Google Scholar
Midkine (MDK) is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors.It affects inflammatory responses, cell proliferation, adhesion, survival, tissue regeneration, differentiation and migration.Animal-Free Midkine Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMidkine protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Midkine (MDK) is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors.It affects inflammatory responses, cell proliferation, adhesion, survival, tissue regeneration, differentiation and migration.Animal-Free Midkine Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMidkine protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.
Background
Midkine (MDK) is a secreted protein functioning as a versatile cytokine and growth factor, transmitting signals through both cell-surface proteoglycan and non-proteoglycan receptors. It engages in diverse cellular processes, such as inflammatory response, cell proliferation, adhesion, survival, tissue regeneration, differentiation, and migration. MDK plays a pivotal role in inflammatory processes by orchestrating the recruitment of neutrophils and macrophages to inflammation sites, exhibiting dual activities that include promoting epithelial cell survival and facilitating smooth muscle cell migration following renal and vessel damage. Moreover, MDK suppresses tolerogenic dendritic cell development, inhibiting regulatory T cell differentiation, and fosters T cell expansion through NFAT signaling, influencing Th1 cell differentiation. The protein's involvement extends to tissue regeneration, contributing to heart damage recovery by negatively regulating inflammatory cell recruitment and mediating cell survival through MAPKs and AKT pathways. Additionally, MDK facilitates liver regeneration, bone repair, and brain development, promoting neural precursor cell survival, neurite outgrowth, and embryonic neurons' survival. Its interactions with various receptors, such as PTPRZ1, ITGA4:ITGB1 complex, LRP1, and GPC2, underscore MDK's intricate regulatory role in diverse physiological processes.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Burns Trauma
Single cell deciphering of pruritic keloids: the interaction between fibroblasts and Schwann cells through the Midkine signaling. [Abstract]2025 Oct 1:13:tkaf057. PMID: 41216187
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
P12025 (K23-D140)
-
Molecular Construction
-
N-term
-
Midkine (K23-D140)
Accession # P12025 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
MDK; Midgestation And Kidney Protein; Prev. NEGF2; ARAP; MK; Neurite Outgrowth-Promoting Protein; Neurite Outgrowth-Promoting Factor 2; Retinoic Acid Inducible Factor; Neurite Growth-Promoting Factor 2; Mutant Truncated Midkine B; Amphiregulin-Associated
-
AA Sequence
KKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD
-
Predicted Molecular Mass
14 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)