Annexin A4 Protein, Human (His-SUMO, Myc)
Annexin A4 Protein, Human (His-SUMO, Myc) is the recombinant human-derived Annexin A4, expressed by E. coli, with C-Myc, N-SUMO, N-10*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Annexin A4 Protein, Human (His-SUMO, Myc) is the recombinant human-derived Annexin A4, expressed by E. coli, with C-Myc, N-SUMO, N-10*His labeled tag.
Background
Annexin IV is a calcium/phospholipid-binding protein that promotes membrane fusion and is involved in exocytosis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-Myc;N-SUMO;N-10*His
-
Accession
P09525-1 (A2-D319)
-
Gene ID307
-
Protein Length
Full Length of Isoform-1
-
Synonyms
ANXA4; P32.5; Prev. ANX4; Annexin IV (Placental Anticoagulant Protein II); Carbohydrate-Binding Protein P33/P41; Epididymis Secretory Protein Li 274; Placental Anticoagulant Protein II; Proliferation-Inducing Protein 28; 35-Beta Calcimedin; Proliferation-
-
AA Sequence
ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
-
Predicted Molecular Mass
55.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
