Annexin A5/ANXA5 Protein, Human (Biotinylated, His-Avi)
Annexin A5 Protein, Human is a 35 kDa multifunctional protein which belongs to the annexin family. Annexin A5 induces in vitro fusion and aggregation of vesicles in a Ca2+- and acidic-pH-dependent manner. Annexin A5 is accepted as an early marker of apoptosis. Annexin A5 has anti-thrombotic and anti-microbial properties. Annexin A5/ANXA5 Protein, Human (Biotinylated, His-Avi) is a recombinant biotinylated Annexin A5 protein expressed by E.coli and tagged with His-Avi.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Annexin A5 Protein, Human is a 35 kDa multifunctional protein which belongs to the annexin family. Annexin A5 induces in vitro fusion and aggregation of vesicles in a Ca2+- and acidic-pH-dependent manner. Annexin A5 is accepted as an early marker of apoptosis. Annexin A5 has anti-thrombotic and anti-microbial properties[1]. Annexin A5/ANXA5 Protein, Human (Biotinylated, His-Avi) is a recombinant biotinylated Annexin A5 protein expressed by E.coli and tagged with His-Avi.
Background
The Annexins comprise a family of proteins that are involved in many aspects of cellular membrane dynamics and the regulation of membrane-associated proteins. Recombinant Human Annexin A5 is a Ca2+-sensitive protein that binds to negatively charged phospholipids, establishing specific interactions with other lipid microdomains[1]. Recombinant Human Annexin A5 promotes delivery of autophagosomes to lysosomes and inhibits endocytosis. Annexin A5 emerges as a possible positive regulator of autophagy and negative regulator of endocytosis through Ca2+ and phospholipid signalling pathways[1][1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-Avi;C-His
-
Accession
P08758 (A2-D320)
-
Gene ID308
-
Molecular Construction
-
N-term
-
ANXA5 (A2-D320)
Accession # P08758 -
His-Avi
-
C-term
-
-
Protein Length
Full Length
-
Conjugation
Biotin
-
Synonyms
ANXA5; RPRGL3; Prev. ANX5; Thromboplastin Inhibitor; Prev. ENX2; Anchorin CII; CPB-I; Lipocortin V; PAP-I; VAC-Alpha; Placental Anticoagulant Protein I; Annexin-5; Vascular Anticoagulant-Alpha; PP4; Calphobindin I; Epididymis Secretory Protein Li 7; Endon
-
AA Sequence
AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
-
Predicted Molecular Mass
39.5 kDa
-
Molecular Weight
Approximately 38 kDa, based on SDS-PAGE under non reducing (N) conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
