ANP32A Protein, Human (His)
Based on 1 Customer Validation
The multifunctional ANP32A protein regulates multiple cellular processes, including tumor suppression, apoptosis, cell cycle progression, and transcription. It promotes apoptosis by activating caspase-9 and supporting apoptotic body formation. ANP32A Protein, Human (His-GST) is the recombinant human-derived ANP32A protein, expressed by E. coli , with N-His, N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The multifunctional ANP32A protein regulates multiple cellular processes, including tumor suppression, apoptosis, cell cycle progression, and transcription. It promotes apoptosis by activating caspase-9 and supporting apoptotic body formation. ANP32A Protein, Human (His-GST) is the recombinant human-derived ANP32A protein, expressed by E. coli , with N-His, N-GST labeled tag.
Background
The ANP32A protein emerges as a multifunctional regulator involved in diverse cellular processes, encompassing tumor suppression, apoptosis, cell cycle progression, and transcription. Functionally versatile, it promotes apoptosis by facilitating the activation of caspase-9 (CASP9) and supporting apoptosome formation. Additionally, ANP32A contributes to the modulation of histone acetylation and transcription as part of the INHAT (inhibitor of histone acetyltransferases) complex. It exerts inhibitory control over EP300/CREBBP and EP300/CREBBP-associated factor by histone masking, preferentially binding to unmodified histone H3 and impeding its acetylation and phosphorylation, leading to cell growth inhibition. Beyond chromatin dynamics, ANP32A participates in various biochemical processes, including the regulation of mRNA nuclear-to-cytoplasmic translocation and stability through its association with ELAVL1 (Hu-antigen R). The protein also plays a role in E4F1-mediated transcriptional repression and inhibits protein phosphatase 2A. Notably, ANP32A is indispensable for influenza A, B, and C viral genome replication, mediating the assembly of viral replicase asymmetric dimers and playing a crucial role in foamy virus mRNA export from the nucleus. This versatile functionality underscores the integral role of ANP32A in orchestrating multiple cellular pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P39687 (E2-K238)
-
Molecular Construction
-
N-term
-
His-GST
-
ANP32A (E2-K238)
Accession # P39687 -
C-term
-
-
Protein Length
Partial
-
Synonyms
ANP32A; Putative HLA-DR-Associated Protein I; Prev. C15orf1; Acidic Nuclear Phosphoprotein Pp32; Mapmodulin; PHAP1; PHAPI; Acidic Leucine-Rich Nuclear Phosphoprotein 32 Family Member; LANP; Putative Human HLA Class II Associated Protein I; MAPM; Cerebella
-
AA Sequence
EMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRK
-
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
