APCDD1 Protein, Mouse (HEK293, His)
The APCDD1 protein acts as a negative regulator, cell-autonomously inhibiting the Wnt signaling pathway and upstream of β-catenin. Its proposed mode of action involves interactions with Wnt and LRP proteins, suggesting a role in regulating the Wnt signaling cascade. APCDD1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived APCDD1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The APCDD1 protein acts as a negative regulator, cell-autonomously inhibiting the Wnt signaling pathway and upstream of β-catenin. Its proposed mode of action involves interactions with Wnt and LRP proteins, suggesting a role in regulating the Wnt signaling cascade. APCDD1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived APCDD1 protein, expressed by HEK293 , with C-His labeled tag.
Background
APCDD1 protein serves as a negative regulator of the Wnt signaling pathway, exerting its inhibitory influence in a cell-autonomous manner and operating upstream of beta-catenin. Its mode of action is proposed to involve interactions with Wnt and LRP proteins, suggesting a role in modulating the intricate Wnt signaling cascade. Functioning as a homodimer, APCDD1 engages in molecular interactions with key components of the Wnt pathway, including LRP5 and WNT3A. These interactions contribute to the protein's regulatory role in suppressing Wnt signaling, highlighting its involvement in cellular processes crucial for proper development and homeostasis.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q3U128 (L27-T492)
-
Molecular Construction
-
N-term
-
APCDD1 (L27-T492)
Accession # Q3U128 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
APCDD1; Adenomatosis Polyposis Coli Down-Regulated 1; APC Down-Regulated 1; Hypoptrichosis Simplex; Protein APCDD1; FP7019; B7323; HYPT1; Adenomatosis Polyposis Coli Down-Regulated 1 Protein; HHS; DRAPC1; HTS
-
AA Sequence
LLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMPPTIEGHWVSTGCEVRSGPEFMTRSYRFYNNNTFKAYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGGTEADYQLHGVQVICHTEAVAEQLSRLVNRTCPGFLAPGGPWVQDVAYDLWQEESNHECTKAVNFAMHELQLIRVEKQYPHHSLDHLVEELFLGDIHTDATQRVFYRPSSYQPPLQNAKNHNHACIACRIIFRSDEHHPPILPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFTIYARGRYSRGVLSSKVMGGTEFVFKVNHMKVTPMDAATASLLNVFSGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDTRGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEELLEDSQGHLYGRAAGRT
-
Predicted Molecular Mass
54.4 kDa
-
Molecular Weight
Approximately 65-68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
