1. Recombinant Proteins
  2. Others
  3. APCDD1 Protein, Mouse (HEK293, His)

The APCDD1 protein acts as a negative regulator, cell-autonomously inhibiting the Wnt signaling pathway and upstream of β-catenin. Its proposed mode of action involves interactions with Wnt and LRP proteins, suggesting a role in regulating the Wnt signaling cascade. APCDD1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived APCDD1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The APCDD1 protein acts as a negative regulator, cell-autonomously inhibiting the Wnt signaling pathway and upstream of β-catenin. Its proposed mode of action involves interactions with Wnt and LRP proteins, suggesting a role in regulating the Wnt signaling cascade. APCDD1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived APCDD1 protein, expressed by HEK293 , with C-His labeled tag.

Background

APCDD1 protein serves as a negative regulator of the Wnt signaling pathway, exerting its inhibitory influence in a cell-autonomous manner and operating upstream of beta-catenin. Its mode of action is proposed to involve interactions with Wnt and LRP proteins, suggesting a role in modulating the intricate Wnt signaling cascade. Functioning as a homodimer, APCDD1 engages in molecular interactions with key components of the Wnt pathway, including LRP5 and WNT3A. These interactions contribute to the protein's regulatory role in suppressing Wnt signaling, highlighting its involvement in cellular processes crucial for proper development and homeostasis.

Species

Mouse

Source

HEK293

Tag

C-8*His

Accession

Q3U128 (L27-T492)

Gene ID
Molecular Construction
N-term
APCDD1 (L27-T492)
Accession # Q3U128
8*His
C-term
Protein Length

Extracellular Domain

Synonyms
Apcdd1; Drapc1; B7323; FP7019; HHS; HTS; HYPT1
AA Sequence

LLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMPPTIEGHWVSTGCEVRSGPEFMTRSYRFYNNNTFKAYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGGTEADYQLHGVQVICHTEAVAEQLSRLVNRTCPGFLAPGGPWVQDVAYDLWQEESNHECTKAVNFAMHELQLIRVEKQYPHHSLDHLVEELFLGDIHTDATQRVFYRPSSYQPPLQNAKNHNHACIACRIIFRSDEHHPPILPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFTIYARGRYSRGVLSSKVMGGTEFVFKVNHMKVTPMDAATASLLNVFSGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDTRGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEELLEDSQGHLYGRAAGRT

Predicted Molecular Mass
54.4 kDa
Molecular Weight

Approximately 65-68 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

APCDD1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

APCDD1 Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
APCDD1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77873
Quantity:
MCE Japan Authorized Agent: