Copy Link Print Information

Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO)

Customer Review

Based on 1 Customer Validation

Apolipoprotein C-III (APOC3) is a component of VLDL and HDL and plays a crucial role in triglyceride homeostasis. Intracellularly, it facilitates the assembly and secretion of VLDL1 for lipid transport. Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Apolipoprotein C-III/APOC3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Apolipoprotein C-III (APOC3) is a component of VLDL and HDL and plays a crucial role in triglyceride homeostasis. Intracellularly, it facilitates the assembly and secretion of VLDL1 for lipid transport. Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Apolipoprotein C-III/APOC3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

Apolipoprotein C-III (APOC3) protein is a vital component of both triglyceride-rich very low-density lipoproteins (VLDL) and high-density lipoproteins (HDL) in plasma, playing a multifaceted role in triglyceride homeostasis. Intracellularly, APOC3 facilitates the assembly and secretion of hepatic very low-density lipoprotein 1 (VLDL1), contributing to lipid transport. Extracellularly, it serves to modulate the hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs), impairing their lipolysis by inhibiting lipoprotein lipase and impeding their hepatic uptake through remnant receptors. Structurally, APOC3 is characterized by several curved helices connected via semiflexible hinges, allowing it to wrap tightly around the curved micelle surface and adapt easily to the different diameters of its natural binding partners. This structural flexibility underscores its versatile involvement in lipid metabolism and transport processes.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His;N-SUMO
  • Accession

    P33622 (E21-S99)

  • Gene ID
    11814  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • APOC3 (E21-S99)
      Accession # P33622
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    APOC3; ApoC-III; Apolipoprotein C3; APOCIII; Apolipoprotein C-III; Apo-C3; Apo-CIII; ApoC-3

  • AA Sequence

    EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES

  • Predicted Molecular Mass

    24.9 kDa

  • Molecular Weight

    Approximately 22-27 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Lyophilized from a 0.22 μm solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO) Product Image
    1/16
  • Apolipoprotein C-III/APOC3 Protein, Mouse (His-SUMO) Product Image