Copy Link Print Information

APRIL/TNFSF13 Protein, Human (HEK293, hFc)

Customer Review

Based on 1 Customer Validation

APRIL/TNFSF13 is a TNF superfamily cytokine that affects tumor cell growth by binding to TNFRSF13B/TACI and TNFRSF17/BCMA receptors. Its homotrimeric structure highlights a potential role in oncogenic processes and immune functions involving monocytes and macrophages. APRIL/TNFSF13 Protein, Human (HEK293, hFc) is the recombinant human-derived APRIL/TNFSF13 protein, expressed by HEK293, with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • APRIL/TNFSF13 Protein, Human (HEK293, hFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

APRIL/TNFSF13 is a TNF superfamily cytokine that affects tumor cell growth by binding to TNFRSF13B/TACI and TNFRSF17/BCMA receptors. Its homotrimeric structure highlights a potential role in oncogenic processes and immune functions involving monocytes and macrophages. APRIL/TNFSF13 Protein, Human (HEK293, hFc) is the recombinant human-derived APRIL/TNFSF13 protein, expressed by HEK293, with N-hFc labeled tag.

Background

APRIL/TNFSF13, a cytokine of the tumor necrosis factor (TNF) superfamily, exerts its biological effects through binding to TNFRSF13B/TACI and TNFRSF17/BCMA receptors. Functioning as a homotrimer, APRIL/TNFSF13 is implicated in the modulation of tumor cell growth, highlighting its potential significance in oncogenic processes. Additionally, APRIL/TNFSF13 may play a role in immunological processes mediated by monocytes and macrophages. Through its interactions with specific receptors, APRIL/TNFSF13 contributes to the intricate regulatory networks governing cell behavior and immune responses. Elucidating the multifaceted functions of APRIL/TNFSF13 provides valuable insights into its role in health and disease, particularly in the context of tumor biology and immune system regulation.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human BCMA, Mouse IgG2a Fc Tag at 5 μg/mL (100 μL/well) can bind Human APRIL Protein, Fc Tag with the EC50 of 1.0-2.0 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-hFc
  • Accession

    O75888-1 (Q111-L250)

  • Gene ID
    8741
  • Molecular Construction
    • N-term
    • hFc
    • AITRL (Q111-L250)
      Accession # O75888-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TNFSF13; ZTNF2; TNF Superfamily Member 13; Tumor Necrosis Factor Ligand Superfamily Member 13 Epsilon; APRIL; Tumor Necrosis Factor-Related Death Ligand-1; Tumor Necrosis Factor Ligand Superfamily Member 13; Tumor Necrosis Factor Superfamily Member 13; A Proliferation-Inducing Ligand; Tumor Necrosis Factor-Like Protein ZTNF2; CD256; Tumor Necrosis Factor Ligand 7B; Tumor Necrosis Factor (Ligand) Superfamily, Member 13; TNF-Related Death Ligand 1; TNF- And APOL-Related Leukocyte Expressed Ligand 2; UNQ383/PRO715; TALL-2; CD256 Antigen; TRDL-1; TNLG7B; TALL2

  • AA Sequence

    QKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

  • Predicted Molecular Mass

    42.2 kDa

  • Molecular Weight

    Approximately 45-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution in PBS, 0.5 M Arginine, pH 7.4 with 10% trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • APRIL/TNFSF13 Protein, Human (HEK293, hFc) Product Image
    1/16
  • APRIL/TNFSF13 Protein, Human (HEK293, hFc) Product Image