APRIL/TNFSF13 Protein, Human (HEK293, hFc)

APRIL/TNFSF13 is a TNF superfamily cytokine that affects tumor cell growth by binding to TNFRSF13B/TACI and TNFRSF17/BCMA receptors. Its homotrimeric structure highlights a potential role in oncogenic processes and immune functions involving monocytes and macrophages. APRIL/TNFSF13 Protein, Human (HEK293, hFc) is the recombinant human-derived APRIL/TNFSF13 protein, expressed by HEK293, with N-hFc labeled tag.

APRIL/TNFSF13, a cytokine of the tumor necrosis factor (TNF) superfamily, exerts its biological effects through binding to TNFRSF13B/TACI and TNFRSF17/BCMA receptors. Functioning as a homotrimer, APRIL/TNFSF13 is implicated in the modulation of tumor cell growth, highlighting its potential significance in oncogenic processes. Additionally, APRIL/TNFSF13 may play a role in immunological processes mediated by monocytes and macrophages. Through its interactions with specific receptors, APRIL/TNFSF13 contributes to the intricate regulatory networks governing cell behavior and immune responses. Elucidating the multifaceted functions of APRIL/TNFSF13 provides valuable insights into its role in health and disease, particularly in the context of tumor biology and immune system regulation.

Measured by its binding ability in a functional ELISA. Immobilized Human BCMA, Mouse IgG2a Fc Tag at 5 μg/mL (100 μL/well) can bind Human APRIL Protein, Fc Tag with the EC₅₀ of 1.31 ng/mL.

Human

HEK293

N-hFc

O75888-1 (Q111-L250)

8741

Partial

QKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

Approximately 45-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in PBS, 0.5 M Arginine, pH 7.4 with 10% trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.