AQP4 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The AQP4 protein forms water-specific channels and is involved in brain water balance and solute transport. AQP4 Protein, Human (His) is the recombinant human-derived AQP4, expressed by E. coli, with N-6*His labeled tag. The total length of AQP4 Protein, Human (His) is 71 a.a..

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The AQP4 protein forms water-specific channels and is involved in brain water balance and solute transport. AQP4 Protein, Human (His) is the recombinant human-derived AQP4, expressed by E. coli, with N-6*His labeled tag. The total length of AQP4 Protein, Human (His) is 71 a.a..

Background

AQP4, a water-specific channel, is instrumental in maintaining brain water homeostasis and facilitating glymphatic solute transport. It plays a crucial role in regulating the exchange of water across the blood-brain interface, influencing cerebrospinal fluid influx into the brain cortex and parenchyma through paravascular spaces surrounding penetrating arteries. Additionally, AQP4 is essential for the proper drainage of interstitial fluid along paravenous pathways, contributing to the normal clearance of solutes, including soluble beta-amyloid peptides derived from APP, from the brain interstitial fluid. While redundant in urinary water homeostasis and concentrating ability, AQP4 forms homotetramers, with the tetramers capable of organizing into oligomeric arrays of varying sizes in membranes. This oligomerization can facilitate cell-cell adhesion through interactions between AQP4 arrays in adjacent cells. AQP4 is also part of a complex involving MLC1, TRPV4, HEPACAM, and ATP1B1, highlighting its role within a larger molecular network.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    AQP4; HAQP4; Aquaporin 4; WCH4; MIWC; Aquaporin Type4 Transcript Variant C; Mercurial-Insensitive Water Channel; Alternative Protein AQP4; Aquaporin-4; Aquaporin Type4; AQP-4; MLC4

  • AA Sequence

    CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

  • Predicted Molecular Mass

    8 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 20% Acetonitrile, pH 4.15.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00