ASGR1/ASGPR1 Protein, Mouse (HEK293, hFc)
ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293, with N-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293, with N-hFc labeled tag.
Background
ASGR1/ASGPR1 Protein assumes a crucial role in cellular processes by mediating the endocytosis of plasma glycoproteins whose terminal sialic acid residue on complex carbohydrate moieties has been removed. The receptor's recognition of terminal galactose and N-acetylgalactosamine units enables the internalization of ligands, forming a complex that is subsequently transported to a sorting organelle. Within this organelle, the receptor and ligand disassociate, and ASGR1/ASGPR1 is recycled back to the cell membrane surface. The protein's involvement in these dynamic processes underscores its significance in the cellular handling of glycoproteins and contributes to the regulation of cellular homeostasis. Notably, ASGR1/ASGPR1 also interacts with LASS2, expanding its molecular associations and suggesting potential implications in cellular signaling or coordination.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
P34927 (Q61-N284)
-
Gene ID11889
-
Molecular Construction
-
N-term
-
hFc
-
ASGR1 (Q61-N284)
Accession # P34927 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ASGR1; ASGR1 Protein; Asialoglycoprotein Receptor 1; ASGP-R 1; CLEC4H1; ASGPR 1; C-Type Lectin Domain Family 4 Member H1; ASGPR1; Hepatic Lectin H1; ASGPR; HL-1
-
AA Sequence
QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
-
Predicted Molecular Mass
52.2 kDa
-
Molecular Weight
Approximately 60-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
